(data stored in ACNUC7421 zone)

EMBL: CP000088.PE401

CP000088.PE401       Location/Qualifiers
FT   CDS             449924..454495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54441"
FT                   /db_xref="GOA:Q47SX6"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54441.1"
FT                   /translation="MTSRRSHETPQGPDPRSPGAAPAYREAPPALTGRELADAVYLAAW
FT                   QQHTAQHPPARPSGGKDTALYAPSRVRGALLARPSQQRHDPKRRRHRVRGALLARPSGG
FT                   KDTAPAAGPQRPGTDPSAAVLGAAEKTAGTEPPRLPPAPAPPSGALRPHPSPLLHRSAL
FT                   YQALRPFRLAATDPWQHSYDAEETARGYARRLLASPHPGGGHRPVAVTPQWAPFVRPGV
FT                   QLTVLVDESVSMLFHQDQVNDFIGLVRSSGVFRGVRVERFTSDSADPAPVPAAGWGASS
FT                   GKDPGGIHIAVVLSDGIGEGWARGSVQSWLGCLAQRLPVAIIHLLDPRQWSRTGIRPAA
FT                   MELTVAAHLGRAPANRHYTARPFQWPDGLPLPEPEFPHSALSVVLPVLASRPEMIHAWA
FT                   RFVMGTRQRTLNAGALRVVPGDTAANAAGERPTAAPTPEARVRRFRRDSSETAFQIAVD
FT                   LAAVPLTEPVIAAVCQRFAGHPQPSELIEVLFSGLVTEVDSPVVTPERRIRWEYRRGVR
FT                   EALLSLGGRRSRIRRTLADIAAEFAGYDPWFALLRRILDDSPVGELPELDETSLRLAAD
FT                   TLPALESIGLADLHHGLVYRIKEQMLAHQGAGHPDDWSDTLLEIAPTGPLVPGSSGQHG
FT                   TTASERVPHAPHPTETPSNSASDESSMMSQRSVSISDNFPGGSGSTGIGAGRNTSLSAI
FT                   WGGDIPPRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRF
FT                   RDEYDLVWWVRGGQTHQIHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWL
FT                   LIFDDVRQPDDIMRYLPIAGPGHVIITTRNLTWPEGGYFKTLPVEVFSLQESVALLSKC
FT                   GLVGFSKHEAAELAEELGHMPIALRQAAAWMNDSATTIAEYLEFYRDKQAQLAPMFAPA
FT                   DPDYPETVITALNVSLDRLAVTNPAALQLLQVCSFFSTAPIPRSLFRHAQDVAAPPELE
FT                   AALQEPNKLHRAFSDIGRYGLAVLNHRTRTVQVHRLVQQALRVPLTADDQEQRRHCAHL
FT                   LLAKNDPQDTSSPGARIRYAQLLPHVWATEAWDCTDSWVRRLVLQEIYVTDLRGEHSDS
FT                   KQLAEATLSVWREKLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGP
FT                   DSEEALEASLEFVRDLRYAGRFHDSVELARDTRDRYRRILGPDDPETISASHVYAYALL
FT                   LAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVDGYAGSLMEAGDYFKALRYQEDNTE
FT                   RIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKDRFGEDSMIAVVAA
FT                   ANHAAALRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEEAR
FT                   VIDERALQVLTDRLGEYHTSTLSSALNLASDFFGLDDVAESVRRDTETLARCRRALSER
FT                   HPLTLLARRNLVLGRKAMNEDVAEEIAAVERLYAEVMGDQHPATLSMRRRERGNADLHL
FT                   NNL"
     MTSRRSHETP QGPDPRSPGA APAYREAPPA LTGRELADAV YLAAWQQHTA QHPPARPSGG        60
     KDTALYAPSR VRGALLARPS QQRHDPKRRR HRVRGALLAR PSGGKDTAPA AGPQRPGTDP       120
     SAAVLGAAEK TAGTEPPRLP PAPAPPSGAL RPHPSPLLHR SALYQALRPF RLAATDPWQH       180
     SYDAEETARG YARRLLASPH PGGGHRPVAV TPQWAPFVRP GVQLTVLVDE SVSMLFHQDQ       240
     VNDFIGLVRS SGVFRGVRVE RFTSDSADPA PVPAAGWGAS SGKDPGGIHI AVVLSDGIGE       300
     GWARGSVQSW LGCLAQRLPV AIIHLLDPRQ WSRTGIRPAA MELTVAAHLG RAPANRHYTA       360
     RPFQWPDGLP LPEPEFPHSA LSVVLPVLAS RPEMIHAWAR FVMGTRQRTL NAGALRVVPG       420
     DTAANAAGER PTAAPTPEAR VRRFRRDSSE TAFQIAVDLA AVPLTEPVIA AVCQRFAGHP       480
     QPSELIEVLF SGLVTEVDSP VVTPERRIRW EYRRGVREAL LSLGGRRSRI RRTLADIAAE       540
     FAGYDPWFAL LRRILDDSPV GELPELDETS LRLAADTLPA LESIGLADLH HGLVYRIKEQ       600
     MLAHQGAGHP DDWSDTLLEI APTGPLVPGS SGQHGTTASE RVPHAPHPTE TPSNSASDES       660
     SMMSQRSVSI SDNFPGGSGS TGIGAGRNTS LSAIWGGDIP PRNALFTGRD DLILRLREQL       720
     RSSSEEGRMT PSVLKGMPGI GKTQLATEYL YRFRDEYDLV WWVRGGQTHQ IHEAYTLLAQ       780
     ELDVFRDNTS INSTIHSVRE ALRRGKPRSR WLLIFDDVRQ PDDIMRYLPI AGPGHVIITT       840
     RNLTWPEGGY FKTLPVEVFS LQESVALLSK CGLVGFSKHE AAELAEELGH MPIALRQAAA       900
     WMNDSATTIA EYLEFYRDKQ AQLAPMFAPA DPDYPETVIT ALNVSLDRLA VTNPAALQLL       960
     QVCSFFSTAP IPRSLFRHAQ DVAAPPELEA ALQEPNKLHR AFSDIGRYGL AVLNHRTRTV      1020
     QVHRLVQQAL RVPLTADDQE QRRHCAHLLL AKNDPQDTSS PGARIRYAQL LPHVWATEAW      1080
     DCTDSWVRRL VLQEIYVTDL RGEHSDSKQL AEATLSVWRE KLGKTAPETL RAELYLVRAL      1140
     RNLGERKRAY ELCERVLRIL TEQHGPDSEE ALEASLEFVR DLRYAGRFHD SVELARDTRD      1200
     RYRRILGPDD PETISASHVY AYALLLAGDH RRAADLFWEI YQTNEMILGP NNPSTLAAVD      1260
     GYAGSLMEAG DYFKALRYQE DNTERIYSLF GINHRGTLEN MAALAAVLRR TGNLERAVKI      1320
     SGEVWRETKD RFGEDSMIAV VAAANHAAAL RSVNRYHEAL DLVEKAYRRC AELLGEDHPH      1380
     VAAINVNRAV VLRQMGRTEE ARVIDERALQ VLTDRLGEYH TSTLSSALNL ASDFFGLDDV      1440
     AESVRRDTET LARCRRALSE RHPLTLLARR NLVLGRKAMN EDVAEEIAAV ERLYAEVMGD      1500
     QHPATLSMRR RERGNADLHL NNL                                              1523
//

If you have problems or comments...

PBIL Back to PBIL home page