(data stored in ACNUC7421 zone)

EMBL: CP000088.PE402

CP000088.PE402       Location/Qualifiers
FT   CDS             455040..455363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54442"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54442.1"
FT                   /translation="MNQLVALAIDDETEILIEPAGERTGPVNVAFPGTQRVRKQLDQVF
FT                   GQIRQIAETVAEKVQDLPGKPDEVTVELGVGLTATADVFIAQSTADASFKVTLTWKDPA
FT                   ART"
     MNQLVALAID DETEILIEPA GERTGPVNVA FPGTQRVRKQ LDQVFGQIRQ IAETVAEKVQ        60
     DLPGKPDEVT VELGVGLTAT ADVFIAQSTA DASFKVTLTW KDPAART                     107
//

If you have problems or comments...

PBIL Back to PBIL home page