(data stored in ACNUC7421 zone)

EMBL: CP000088.PE404

CP000088.PE404       Location/Qualifiers
FT   CDS             complement(456285..458159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0406"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54444"
FT                   /db_xref="GOA:Q47SX3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54444.1"
FT                   /translation="MPSDGLPKNLEPLAAGDPATIGPYVLVGRLGSGGMGTVYLGRAPE
FT                   KGTHVAIKVIRPELAFDEATRARFRDEMENARKVASFCTAKVLDHGTFQNRPYMVTEYI
FT                   AGTALAEHIAEHGPLDSGTLHGFALGVAAALAAIHKAGLVHRDLKPANVLLSLSGPRVI
FT                   DFGIARALNTSTSHTQTGIVMGSPGWMAPEQLLEEKVTTKADIFAWGCLVAFAGNGRHP
FT                   FGNGDAMTLGKRMLFAEPDIGNLDPPLDRLVARALAKDPDQRPTAQELLLELAGGTDSN
FT                   DTNDVVSHALHQSWRPNFPPMPPGYPPPSPQAHSGMPGPQAQAQAPGQTTIAPQPYAHP
FT                   QQGGPGPMPPQAAGPQGGPQGGPQSPPMPQRPGPQASHHTGQIPVVPPTTGRQPPRSPA
FT                   AQGSSGGPQARPYVPPNTLPPHRPLRPDSSRSRLLIVFAVLGAVLLAVVLVFGLVFFQD
FT                   WFSSTSDTNPPGQGQEQQSSAPKEDPDDESDKSDTQAADPQAGESLRFDLLDWYCGNQV
FT                   LDRPLIVNGGEYCVAEIEAHNSANYPVKFRHDLQILAHASGEQTKADAPLHGEGADPLW
FT                   AGPIQPGDTVRGYLVFIVHSELTPEVLILRSTVDSPGQQIEIPSGQPA"
     MPSDGLPKNL EPLAAGDPAT IGPYVLVGRL GSGGMGTVYL GRAPEKGTHV AIKVIRPELA        60
     FDEATRARFR DEMENARKVA SFCTAKVLDH GTFQNRPYMV TEYIAGTALA EHIAEHGPLD       120
     SGTLHGFALG VAAALAAIHK AGLVHRDLKP ANVLLSLSGP RVIDFGIARA LNTSTSHTQT       180
     GIVMGSPGWM APEQLLEEKV TTKADIFAWG CLVAFAGNGR HPFGNGDAMT LGKRMLFAEP       240
     DIGNLDPPLD RLVARALAKD PDQRPTAQEL LLELAGGTDS NDTNDVVSHA LHQSWRPNFP       300
     PMPPGYPPPS PQAHSGMPGP QAQAQAPGQT TIAPQPYAHP QQGGPGPMPP QAAGPQGGPQ       360
     GGPQSPPMPQ RPGPQASHHT GQIPVVPPTT GRQPPRSPAA QGSSGGPQAR PYVPPNTLPP       420
     HRPLRPDSSR SRLLIVFAVL GAVLLAVVLV FGLVFFQDWF SSTSDTNPPG QGQEQQSSAP       480
     KEDPDDESDK SDTQAADPQA GESLRFDLLD WYCGNQVLDR PLIVNGGEYC VAEIEAHNSA       540
     NYPVKFRHDL QILAHASGEQ TKADAPLHGE GADPLWAGPI QPGDTVRGYL VFIVHSELTP       600
     EVLILRSTVD SPGQQIEIPS GQPA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page