(data stored in ACNUC7421 zone)

EMBL: CP000088.PE409

CP000088.PE409       Location/Qualifiers
FT   CDS             complement(462889..463383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0411"
FT                   /product="regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54449"
FT                   /db_xref="GOA:Q47SW8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SW8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54449.1"
FT                   /translation="MRDEVDGLVEAWRTERPDLDVAPLQVLSRVSRLARHLDRARRSVF
FT                   AAHDLEPWEFDVLAELRRSGHPYELSPGRLMRATLVTSGTMTNRIDRLTEDGLVRRLPD
FT                   PTDRRGVLVRLTDEGRERVDAALADLLRYEESLLAALTTAERDQLATLLRTVLAPLDEP
FT                   D"
     MRDEVDGLVE AWRTERPDLD VAPLQVLSRV SRLARHLDRA RRSVFAAHDL EPWEFDVLAE        60
     LRRSGHPYEL SPGRLMRATL VTSGTMTNRI DRLTEDGLVR RLPDPTDRRG VLVRLTDEGR       120
     ERVDAALADL LRYEESLLAA LTTAERDQLA TLLRTVLAPL DEPD                        164
//

If you have problems or comments...

PBIL Back to PBIL home page