(data stored in ACNUC7421 zone)

EMBL: CP000088.PE41

CP000088.PE41        Location/Qualifiers
FT   CDS             complement(44490..45761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0043"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54081"
FT                   /db_xref="GOA:Q47TY3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54081.1"
FT                   /translation="MALIVQKYGGSSVADADAIKRVAERIVAQKKAGYDVVVVVSAMGD
FT                   TTDELLDLAKQVSPLPPGRELDMLLTAGERISMALVAMAIGNLGYEARSFTGSQAGVIT
FT                   TSLHGNAKIIDVTPGRIRDALAEGAICIVAGFQGVSQDSKDITTLGRGGSDTTAVALAA
FT                   ALNADLCEIYTDVDGVFTADPRIVPSARRIPQISYEEMLEMAASGAKILHLRCVEYARR
FT                   YNIPLHVRSSFSQKPGTWVVSEVEETEGMEQPIISGVAHDRSEAKITVVGVPDRVGEAA
FT                   AIFKALADAEINVDMIVQNVSAASTSRTDISFTLPADSGQNALAALKKIQDKVGFESLL
FT                   YNDRIGKVSLIGAGMRSYPGVTARFFDAVAREGINIEMISTSEIRISIVVAQDDVDAAV
FT                   AAAHREFQLDADQVEAVVYGGTGR"
     MALIVQKYGG SSVADADAIK RVAERIVAQK KAGYDVVVVV SAMGDTTDEL LDLAKQVSPL        60
     PPGRELDMLL TAGERISMAL VAMAIGNLGY EARSFTGSQA GVITTSLHGN AKIIDVTPGR       120
     IRDALAEGAI CIVAGFQGVS QDSKDITTLG RGGSDTTAVA LAAALNADLC EIYTDVDGVF       180
     TADPRIVPSA RRIPQISYEE MLEMAASGAK ILHLRCVEYA RRYNIPLHVR SSFSQKPGTW       240
     VVSEVEETEG MEQPIISGVA HDRSEAKITV VGVPDRVGEA AAIFKALADA EINVDMIVQN       300
     VSAASTSRTD ISFTLPADSG QNALAALKKI QDKVGFESLL YNDRIGKVSL IGAGMRSYPG       360
     VTARFFDAVA REGINIEMIS TSEIRISIVV AQDDVDAAVA AAHREFQLDA DQVEAVVYGG       420
     TGR                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page