(data stored in ACNUC7421 zone)

EMBL: CP000088.PE414

CP000088.PE414       Location/Qualifiers
FT   CDS             468906..469490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0416"
FT                   /product="LSU ribosomal protein L25P"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54454"
FT                   /db_xref="GOA:Q47SW3"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54454.1"
FT                   /translation="MSEVRIAAEPRTEFGKGAARRARRAGKVPAVLYGHGIAPRHINLP
FT                   GHDLMLALKTPNVLLRLEGVDEKESLVLPKSVQRDPIKGFLEHVDLLVVQRGEKVVVEV
FT                   PLLVKGEVGAGGVLNLEMAQAEVRAEATRIPEGIEVDVDGLPIGTNVTAGDLKLPEGVE
FT                   LAMDPETIVMSVVAEAAPEATEEEEEGEAAE"
     MSEVRIAAEP RTEFGKGAAR RARRAGKVPA VLYGHGIAPR HINLPGHDLM LALKTPNVLL        60
     RLEGVDEKES LVLPKSVQRD PIKGFLEHVD LLVVQRGEKV VVEVPLLVKG EVGAGGVLNL       120
     EMAQAEVRAE ATRIPEGIEV DVDGLPIGTN VTAGDLKLPE GVELAMDPET IVMSVVAEAA       180
     PEATEEEEEG EAAE                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page