(data stored in ACNUC7421 zone)

EMBL: CP000088.PE425

CP000088.PE425       Location/Qualifiers
FT   CDS             complement(482030..483475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0427"
FT                   /product="cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54465"
FT                   /db_xref="GOA:Q47SV2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54465.1"
FT                   /translation="MTYTTAPRLRRRHTIELAMLAVALTVFATGLCLTGLQLHAQVPDL
FT                   LWLATAVLGGSALAVHVALRFCAPWADPLILPLAVLLNGIGFIVIWGLHAEAGDPPTAA
FT                   FRQLLWTGLGQLGCLTTVLLVRHPQRLQRYPYLMALAGLVLLASPMLPVIGLDQYGSRR
FT                   WLSFNGFTVQPSEFAKIPLVLFLAAYLGMKRDILALAAAQITVRGVKIFSVPRMRDMGP
FT                   MTAAWGIAILILVGTKDLGTSLLLFTVFLAMLYTATLRKSWVGIGVAMFLAGAYVAYLL
FT                   FWHVRQRVTIWLHAFDPGVYYAPQGSAQVVEGLFALADGGLFGLGFGQGRAATLFASDS
FT                   DLIMVSVGEKFGLAGVAAVLLVTLLLVERAFRVALAARDTFVKLMTTGFAFLWAFQVFV
FT                   VVGGVTLLIPLSGMTTPLLSVGGSSLVTTWIMLGLWLRVSSEVRRAAVSRCHDDTATME
FT                   LPRSAVSPTPPPTASNKSATDQE"
     MTYTTAPRLR RRHTIELAML AVALTVFATG LCLTGLQLHA QVPDLLWLAT AVLGGSALAV        60
     HVALRFCAPW ADPLILPLAV LLNGIGFIVI WGLHAEAGDP PTAAFRQLLW TGLGQLGCLT       120
     TVLLVRHPQR LQRYPYLMAL AGLVLLASPM LPVIGLDQYG SRRWLSFNGF TVQPSEFAKI       180
     PLVLFLAAYL GMKRDILALA AAQITVRGVK IFSVPRMRDM GPMTAAWGIA ILILVGTKDL       240
     GTSLLLFTVF LAMLYTATLR KSWVGIGVAM FLAGAYVAYL LFWHVRQRVT IWLHAFDPGV       300
     YYAPQGSAQV VEGLFALADG GLFGLGFGQG RAATLFASDS DLIMVSVGEK FGLAGVAAVL       360
     LVTLLLVERA FRVALAARDT FVKLMTTGFA FLWAFQVFVV VGGVTLLIPL SGMTTPLLSV       420
     GGSSLVTTWI MLGLWLRVSS EVRRAAVSRC HDDTATMELP RSAVSPTPPP TASNKSATDQ       480
     E                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page