(data stored in ACNUC7421 zone)

EMBL: CP000088.PE428

CP000088.PE428       Location/Qualifiers
FT   CDS             485831..486397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54468"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54468.1"
FT                   /translation="MNSADQLPARRVSAEDVEIIRQQLGRPPRAVYEVAHRCPCGLPDV
FT                   VRTAPRLADGSPFPTLYYLTCPRAASAIGRLESSGLMREMTERLQHDAELRAAYTRAHE
FT                   SYLAERAALAEKLGLEPLPKGMQSAGGMPKRVKCLHALVAHELAVPGSNPLGREALDQL
FT                   PPWWDRGPCVCSDRSEKTERNGKDQ"
     MNSADQLPAR RVSAEDVEII RQQLGRPPRA VYEVAHRCPC GLPDVVRTAP RLADGSPFPT        60
     LYYLTCPRAA SAIGRLESSG LMREMTERLQ HDAELRAAYT RAHESYLAER AALAEKLGLE       120
     PLPKGMQSAG GMPKRVKCLH ALVAHELAVP GSNPLGREAL DQLPPWWDRG PCVCSDRSEK       180
     TERNGKDQ                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page