(data stored in ACNUC7421 zone)

EMBL: CP000088.PE435

CP000088.PE435       Location/Qualifiers
FT   CDS             complement(495017..496060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0437"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54475"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54475.1"
FT                   /translation="MALRAAQARRIMAATMFGGGGLTLLAASTVALLFLQAKIAARTIG
FT                   VTPWQRPRVDGVYGVGGGEPLTLLMMGDSTAAGFAVSDPRQTPPVQLASGLSAVADRPV
FT                   RLRDVSKVGATSQGLLAQLDRVRGERVDLAVIFIGANDVIDRIRPADAVSHLRVVVREL
FT                   VASGAAVVVATCPDLGTVQPIPQPLRAIARRASQQMAAAQTVAVVEEGGSTVALGDLLS
FT                   DEFSLYPEEMFGPDRFHPSARGYGRAVAVVLPALCSALGLLPEPVESEPDAEEVLPVDR
FT                   AAAAAVAAAGSEVRQAGQEEHRRGSLGLWARLLRRDTAPAADTHKLETDSNSVKATPAA
FT                   SVGSRIG"
     MALRAAQARR IMAATMFGGG GLTLLAASTV ALLFLQAKIA ARTIGVTPWQ RPRVDGVYGV        60
     GGGEPLTLLM MGDSTAAGFA VSDPRQTPPV QLASGLSAVA DRPVRLRDVS KVGATSQGLL       120
     AQLDRVRGER VDLAVIFIGA NDVIDRIRPA DAVSHLRVVV RELVASGAAV VVATCPDLGT       180
     VQPIPQPLRA IARRASQQMA AAQTVAVVEE GGSTVALGDL LSDEFSLYPE EMFGPDRFHP       240
     SARGYGRAVA VVLPALCSAL GLLPEPVESE PDAEEVLPVD RAAAAAVAAA GSEVRQAGQE       300
     EHRRGSLGLW ARLLRRDTAP AADTHKLETD SNSVKATPAA SVGSRIG                     347
//

If you have problems or comments...

PBIL Back to PBIL home page