(data stored in ACNUC7421 zone)

EMBL: CP000088.PE44

CP000088.PE44        Location/Qualifiers
FT   CDS             47324..49162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54084"
FT                   /db_xref="GOA:Q47TY0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TY0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54084.1"
FT                   /translation="MTTTTIPPISEYAMLSDCRTAALVAPDSTIEWLCAPRFDSPSVFA
FT                   RLLDRHHGGAWEWTVPEATTVHRDYLAETLVLRTRWHTPNGTAVGHDFLAVVPRHASGI
FT                   APAGILVRLLHCERGTVRLQSRITARPDYSTRDAHWTSRSHALIDEHSGLLLSGPAETI
FT                   PDRSGAVVTDMVLRAGESVALGLDYTGDMLRRVDATTAHHLLTQTTHTWQAWASRSDYQ
FT                   GVAADWVRHSAVVLKGLISDDSGALITAPTTSLSEWPGGARNWDYRYAWRRDTARTIRA
FT                   LLRLGHHNDAGQLLRFLLDYCAEKENRVPPVTRIDNTPLPNETTLTHLSGYHDSRPVRI
FT                   HSDAYRQHQLDVYGHILEAAFAYHEATGHTSLTDLNELRKVVEIAGRLWRHPDAGVWGI
FT                   NTSPRHWTESKLYAWVCFDRAIRLFQQTGTVPADTLDQWQAERDAIRTDVIAKGCHAGL
FT                   GRFVQTYGAANVDGSLLHIPLVDFLPGTDPRVVATIDRIDAELGEAGFLVHRYDASTTR
FT                   DDVPDTGEGAFLPCSFDMVSALVLANRVDEAHHRFTTLCAHAGALRLFAEEMTADGTML
FT                   GNYPHAFTHLALIEAALHLDEAQRERAHRVEARRPA"
     MTTTTIPPIS EYAMLSDCRT AALVAPDSTI EWLCAPRFDS PSVFARLLDR HHGGAWEWTV        60
     PEATTVHRDY LAETLVLRTR WHTPNGTAVG HDFLAVVPRH ASGIAPAGIL VRLLHCERGT       120
     VRLQSRITAR PDYSTRDAHW TSRSHALIDE HSGLLLSGPA ETIPDRSGAV VTDMVLRAGE       180
     SVALGLDYTG DMLRRVDATT AHHLLTQTTH TWQAWASRSD YQGVAADWVR HSAVVLKGLI       240
     SDDSGALITA PTTSLSEWPG GARNWDYRYA WRRDTARTIR ALLRLGHHND AGQLLRFLLD       300
     YCAEKENRVP PVTRIDNTPL PNETTLTHLS GYHDSRPVRI HSDAYRQHQL DVYGHILEAA       360
     FAYHEATGHT SLTDLNELRK VVEIAGRLWR HPDAGVWGIN TSPRHWTESK LYAWVCFDRA       420
     IRLFQQTGTV PADTLDQWQA ERDAIRTDVI AKGCHAGLGR FVQTYGAANV DGSLLHIPLV       480
     DFLPGTDPRV VATIDRIDAE LGEAGFLVHR YDASTTRDDV PDTGEGAFLP CSFDMVSALV       540
     LANRVDEAHH RFTTLCAHAG ALRLFAEEMT ADGTMLGNYP HAFTHLALIE AALHLDEAQR       600
     ERAHRVEARR PA                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page