(data stored in ACNUC7421 zone)

EMBL: CP000088.PE442

CP000088.PE442       Location/Qualifiers
FT   CDS             504366..505604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54482"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54482.1"
FT                   /translation="MQGEPATRENGDARERPLTVDGEEATVTRFSDALATGVDLVSAAE
FT                   RATRQALERLDGPADLVCVFVSGIDPEEVALAGERAMALAEGATTIGCSAGGVIGGGRG
FT                   TEGQGAVSVWAAMLPGVTMTPFELAAIAEGDQLAVIGVLEPTPADQAALLLANPYVFPT
FT                   HTFVEHSNTILDGLPIVGGLADGTYGGDSVRLFLQGETVQAGAVGLLFGGNGVLGTVVS
FT                   QGCRPIGPSMVVTKAEDNVLIELAGTPAYAKLESIVSALPPEEQQLVADGLHIGIAIDE
FT                   YADRHESGDFLIRGVLDADPEQSTITIGDVVDVGQTVRFQVRDQATADSDLLERLRLFA
FT                   HDTGGTAEGALLFSCNGRGSGMFPSADHDVRRVQQILGIDAVGGFFAAGEIGPVAGRNH
FT                   LHGFTACMLAFRG"
     MQGEPATREN GDARERPLTV DGEEATVTRF SDALATGVDL VSAAERATRQ ALERLDGPAD        60
     LVCVFVSGID PEEVALAGER AMALAEGATT IGCSAGGVIG GGRGTEGQGA VSVWAAMLPG       120
     VTMTPFELAA IAEGDQLAVI GVLEPTPADQ AALLLANPYV FPTHTFVEHS NTILDGLPIV       180
     GGLADGTYGG DSVRLFLQGE TVQAGAVGLL FGGNGVLGTV VSQGCRPIGP SMVVTKAEDN       240
     VLIELAGTPA YAKLESIVSA LPPEEQQLVA DGLHIGIAID EYADRHESGD FLIRGVLDAD       300
     PEQSTITIGD VVDVGQTVRF QVRDQATADS DLLERLRLFA HDTGGTAEGA LLFSCNGRGS       360
     GMFPSADHDV RRVQQILGID AVGGFFAAGE IGPVAGRNHL HGFTACMLAF RG               412
//

If you have problems or comments...

PBIL Back to PBIL home page