(data stored in ACNUC7421 zone)

EMBL: CP000088.PE447

CP000088.PE447       Location/Qualifiers
FT   CDS             508364..509236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54487"
FT                   /db_xref="GOA:Q47ST0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q47ST0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54487.1"
FT                   /translation="MSERLRLMAVHAHPDDESSKGAATMARYVNEGAEVLVVTLTGGER
FT                   GSILNPAMDRPEIRENIAEVRRKEMEEARRILGVRQVFVGFIDSGLPEGDPPPPLPEGC
FT                   FALQPLEVAAEPVVRLVREFRPHVMITYDEQGGYPHPDHIMCHKVSVEAFEAAADPERY
FT                   PGTGEPWQTSKLYYHVSFPLERFEAIAKVLSDRGMENPYADWMKRLEKRDTRRWEITTR
FT                   VECGEYFEVRDRALLAHATQIDPNSFWFAVPNDIQREAWPTEDYHLARSFVDTELPEDD
FT                   LFAGIRDKV"
     MSERLRLMAV HAHPDDESSK GAATMARYVN EGAEVLVVTL TGGERGSILN PAMDRPEIRE        60
     NIAEVRRKEM EEARRILGVR QVFVGFIDSG LPEGDPPPPL PEGCFALQPL EVAAEPVVRL       120
     VREFRPHVMI TYDEQGGYPH PDHIMCHKVS VEAFEAAADP ERYPGTGEPW QTSKLYYHVS       180
     FPLERFEAIA KVLSDRGMEN PYADWMKRLE KRDTRRWEIT TRVECGEYFE VRDRALLAHA       240
     TQIDPNSFWF AVPNDIQREA WPTEDYHLAR SFVDTELPED DLFAGIRDKV                  290
//

If you have problems or comments...

PBIL Back to PBIL home page