(data stored in ACNUC7421 zone)

EMBL: CP000088.PE448

CP000088.PE448       Location/Qualifiers
FT   CDS             509248..509466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54488"
FT                   /db_xref="GOA:Q47SS9"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54488.1"
FT                   /translation="MNLSALQLADSVNDLVTPGLLGFTVIALIGGVLFLLMRSMRRHLD
FT                   IARSRDFTEDSAKEKEAEQTKPEDRED"
     MNLSALQLAD SVNDLVTPGL LGFTVIALIG GVLFLLMRSM RRHLDIARSR DFTEDSAKEK        60
     EAEQTKPEDR ED                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page