(data stored in ACNUC7421 zone)

EMBL: CP000088.PE45

CP000088.PE45        Location/Qualifiers
FT   CDS             complement(49207..52773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0047"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54085"
FT                   /db_xref="GOA:Q47TX9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54085.1"
FT                   /translation="MTNDPFVHLHVHTEYSMLDGAAKLKPLFEEAARLGMPAVAMTDHG
FT                   NMFGSYEFWQTSKESGVKPIIGIEAYVAPESRFHKQRVFWGTGKTGDEAAEGGKDVSGG
FT                   GRYLHLTMWARNAKGLRNLFRLSSLASFEGYYTKPRMDLELMAQYSEGIMVTTGCPSGG
FT                   VQTRLRLGQEREAIEYAGKLRDIFGRDSVFVELMDHGLDIEREVRSGLLTVAKKLGLRP
FT                   VVTNDSHYVTEDQAAAHDALLAVGVGKNLDDPTRFRFNGTGYYLKSAEEMRSLNTFDEW
FT                   LEGCRNTLWIAEQVEDGAYDDVFRPRDLMPKFPVPEGETQASWLRKEIERCIPNRYPNG
FT                   PSREVRERIEHELSIIERMGFPAYFLVVADICQYARRSGIALGPGRGSATGSMVAYVLG
FT                   ITDLDPLEHSLLFERFLNPERVSMPDIDLDFDERKRGDMIRYVTERYGEDRVAQILTFG
FT                   TIKAKAAIKDATRILGYPYALGDKITKAFPPAVGGKEIPLSAVFDESHPRYNEAAELRQ
FT                   LIESNPDVRKVYETASGLEGLTRGTGVHAAGVILSAEPLLDVIPLHKRETDGAIITGFP
FT                   YPQCEEMGLLKMDFLGLRNLTVIDDAIQNIKANEGKEINLSALPLDNKKTYELLSRGDT
FT                   LGVFQLDGGPMRALLKRMEPKKFGDIAAVLALYRPGPMAANAHNDYADRSNGRQEITPI
FT                   HPELKEALDPILAESFHLIVYQEQVMAIAQQLAGYTLGGADLLRRAMGKKKKEALEKEY
FT                   TKFSEGMLSRGFSKEAMQALWDVMLPFSGYAFNKSHTAGYGMISYWTAYLKANHPASYM
FT                   AALLTSVADDKDKMAVYLAECRKMGIRVLPPDVNESGLQFTPVGNDIRFGLGAVRNVGA
FT                   NVVESILKTREEKGKFTSFVDFLSKIELTVCNKRVIESLIKAGAFDSLGHSRLDLYRHH
FT                   EAAVDAVLSSKKQEAHGQFDLFGGGDEEDGGESAPLGFSINWTGEEWDRKTKLAFEREM
FT                   LGLYVSSHPLAGAERILARASDAPLLDVVNGERRNNDEVRIAGLISKVEKRINKAGNQW
FT                   AIATVEDLDASIEALFFPKVYPLYVDALVEDTAVSIKGRLNDRDGTFSLFVSEMSILDI
FT                   SHVSEGEPPVLLTIPEKRVTRELISELKQTLRSHRGDTPVRIRVDNPRRSRIFAIDDYP
FT                   VRVSPEFSGEVKSLLGPESITY"
     MTNDPFVHLH VHTEYSMLDG AAKLKPLFEE AARLGMPAVA MTDHGNMFGS YEFWQTSKES        60
     GVKPIIGIEA YVAPESRFHK QRVFWGTGKT GDEAAEGGKD VSGGGRYLHL TMWARNAKGL       120
     RNLFRLSSLA SFEGYYTKPR MDLELMAQYS EGIMVTTGCP SGGVQTRLRL GQEREAIEYA       180
     GKLRDIFGRD SVFVELMDHG LDIEREVRSG LLTVAKKLGL RPVVTNDSHY VTEDQAAAHD       240
     ALLAVGVGKN LDDPTRFRFN GTGYYLKSAE EMRSLNTFDE WLEGCRNTLW IAEQVEDGAY       300
     DDVFRPRDLM PKFPVPEGET QASWLRKEIE RCIPNRYPNG PSREVRERIE HELSIIERMG       360
     FPAYFLVVAD ICQYARRSGI ALGPGRGSAT GSMVAYVLGI TDLDPLEHSL LFERFLNPER       420
     VSMPDIDLDF DERKRGDMIR YVTERYGEDR VAQILTFGTI KAKAAIKDAT RILGYPYALG       480
     DKITKAFPPA VGGKEIPLSA VFDESHPRYN EAAELRQLIE SNPDVRKVYE TASGLEGLTR       540
     GTGVHAAGVI LSAEPLLDVI PLHKRETDGA IITGFPYPQC EEMGLLKMDF LGLRNLTVID       600
     DAIQNIKANE GKEINLSALP LDNKKTYELL SRGDTLGVFQ LDGGPMRALL KRMEPKKFGD       660
     IAAVLALYRP GPMAANAHND YADRSNGRQE ITPIHPELKE ALDPILAESF HLIVYQEQVM       720
     AIAQQLAGYT LGGADLLRRA MGKKKKEALE KEYTKFSEGM LSRGFSKEAM QALWDVMLPF       780
     SGYAFNKSHT AGYGMISYWT AYLKANHPAS YMAALLTSVA DDKDKMAVYL AECRKMGIRV       840
     LPPDVNESGL QFTPVGNDIR FGLGAVRNVG ANVVESILKT REEKGKFTSF VDFLSKIELT       900
     VCNKRVIESL IKAGAFDSLG HSRLDLYRHH EAAVDAVLSS KKQEAHGQFD LFGGGDEEDG       960
     GESAPLGFSI NWTGEEWDRK TKLAFEREML GLYVSSHPLA GAERILARAS DAPLLDVVNG      1020
     ERRNNDEVRI AGLISKVEKR INKAGNQWAI ATVEDLDASI EALFFPKVYP LYVDALVEDT      1080
     AVSIKGRLND RDGTFSLFVS EMSILDISHV SEGEPPVLLT IPEKRVTREL ISELKQTLRS      1140
     HRGDTPVRIR VDNPRRSRIF AIDDYPVRVS PEFSGEVKSL LGPESITY                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page