(data stored in ACNUC7421 zone)

EMBL: CP000088.PE450

CP000088.PE450       Location/Qualifiers
FT   CDS             511624..512421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54490"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54490.1"
FT                   /translation="MTGAWRSLVNPPLCSLSDEMQETTEWFTGDTVIPFARLVRAGSGG
FT                   QGKEERVRATRAAAFPLAASILAAPACGFGTPSQVMPGLAHPMASSESGFQVSDEATLH
FT                   NYTGINVVLPDGWHTDIADNCLSPPEVGPAPGGNCPSEALRIRINASEEGLIDPEGAEL
FT                   TDPDSWRRPWASCPKRPELNARIRAEHSEIVEHGDFLLVSGEETKYSEWLITCTGGGTF
FT                   RTRAWYVPEADLEFDVPVMVEERAEEYDLIVRSADLSRFKAIS"
     MTGAWRSLVN PPLCSLSDEM QETTEWFTGD TVIPFARLVR AGSGGQGKEE RVRATRAAAF        60
     PLAASILAAP ACGFGTPSQV MPGLAHPMAS SESGFQVSDE ATLHNYTGIN VVLPDGWHTD       120
     IADNCLSPPE VGPAPGGNCP SEALRIRINA SEEGLIDPEG AELTDPDSWR RPWASCPKRP       180
     ELNARIRAEH SEIVEHGDFL LVSGEETKYS EWLITCTGGG TFRTRAWYVP EADLEFDVPV       240
     MVEERAEEYD LIVRSADLSR FKAIS                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page