(data stored in ACNUC7421 zone)

EMBL: CP000088.PE451

CP000088.PE451       Location/Qualifiers
FT   CDS             512808..513197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54491"
FT                   /db_xref="GOA:Q47SS6"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54491.1"
FT                   /translation="MQSFFWVIPALVLAVAVFYSVVAVAIRDEETERTLFDPVFPVSFR
FT                   GLVRGLVNFRVANPPATVHGALRRLREQQGRDIAEPGLDSDVSIAGADHAVTAVSRSAP
FT                   QLRRDDAPAAREDAGPAPETRCSAR"
     MQSFFWVIPA LVLAVAVFYS VVAVAIRDEE TERTLFDPVF PVSFRGLVRG LVNFRVANPP        60
     ATVHGALRRL REQQGRDIAE PGLDSDVSIA GADHAVTAVS RSAPQLRRDD APAAREDAGP       120
     APETRCSAR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page