(data stored in ACNUC7421 zone)

EMBL: CP000088.PE456

CP000088.PE456       Location/Qualifiers
FT   CDS             519232..519882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0458"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54496"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SS1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54496.1"
FT                   /translation="MRPLKGQSLLKNRISLRLATAAGTAALTVAGATFGFSAFAADTGA
FT                   APDQAASAAILPDEADTESFFPDDSQGVPAGQLEQASTEREQALAQSLATASGTLEEEK
FT                   EEEEEPEPVSIPSGDPRAIAQAMLADYGWGSDQFSCLDSLWQRESNWNPQARNPYSGAY
FT                   GIPQALPGEKMASAGSDWQTNPATQIKWGLGYIKDRYGSPCAAWEHSQSVGWY"
     MRPLKGQSLL KNRISLRLAT AAGTAALTVA GATFGFSAFA ADTGAAPDQA ASAAILPDEA        60
     DTESFFPDDS QGVPAGQLEQ ASTEREQALA QSLATASGTL EEEKEEEEEP EPVSIPSGDP       120
     RAIAQAMLAD YGWGSDQFSC LDSLWQRESN WNPQARNPYS GAYGIPQALP GEKMASAGSD       180
     WQTNPATQIK WGLGYIKDRY GSPCAAWEHS QSVGWY                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page