(data stored in ACNUC7421 zone)

EMBL: CP000088.PE460

CP000088.PE460       Location/Qualifiers
FT   CDS             523447..524253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0462"
FT                   /product="nodulation protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54500"
FT                   /db_xref="GOA:Q47SR7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54500.1"
FT                   /translation="MTATENTTVDRPRPGGFEFAPVLGILAREWALYRRTWAPITFSSI
FT                   VEPVLYLLAFGMGMGALVGSIGGYDYIEFLGTGIVAISALFTSMFPGLINTFVRRRFQH
FT                   TYEGVLAAPVDVRELVTGEALWLGLKAGVYGCAPLLVAFGFGLDPVWPMLFVPVIAAAT
FT                   GFGFALFGILLSAIIPSIRMADYVISGVITPIFLVAGTFFPIDQLPEWAQTAAMANPLY
FT                   HCVELIRGCAFGIEALTALGHVAVLVGFAVVVWVLAVHQMQRRLID"
     MTATENTTVD RPRPGGFEFA PVLGILAREW ALYRRTWAPI TFSSIVEPVL YLLAFGMGMG        60
     ALVGSIGGYD YIEFLGTGIV AISALFTSMF PGLINTFVRR RFQHTYEGVL AAPVDVRELV       120
     TGEALWLGLK AGVYGCAPLL VAFGFGLDPV WPMLFVPVIA AATGFGFALF GILLSAIIPS       180
     IRMADYVISG VITPIFLVAG TFFPIDQLPE WAQTAAMANP LYHCVELIRG CAFGIEALTA       240
     LGHVAVLVGF AVVVWVLAVH QMQRRLID                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page