(data stored in ACNUC7421 zone)

EMBL: CP000088.PE461

CP000088.PE461       Location/Qualifiers
FT   CDS             complement(524336..526009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54501"
FT                   /db_xref="InterPro:IPR021787"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54501.1"
FT                   /translation="MPPGHPAGPPPSHGQPQGPPPGQPQGAPPGQPQGAPPGQPQGVPS
FT                   GQPQGAPSGAALAAPHGPGGPGFPPSGQPMHSGPGGPPPRKKPVWLIPLSIVLAVALIG
FT                   GGVWASVALVNNLFGGAQPESVLPRSSAVFAKLDLKPTGQQWASYAQFYERLPDTLKDE
FT                   FESAEDDFGEELFEELFPNVELDYASEVEPWLGQRFGVAVWAGNEEPLYAIALAVEDEE
FT                   LAEETLTRIQSEDDTLFFEVVDGFAILTDSQDALNDRRFLVENEGTLEDNEDFADDISD
FT                   IGRGIATAWIDYGAIVHNEVLAADADLEDLAELGQVTGRLVAVVRMESKYLEFQANLVN
FT                   AALDGNTIFAESVPTGGITALHDLPDNSVIALGGDGLDAVAQAFWEANQGSIESSEDYE
FT                   EFDSAMRELGVRLPADFHKLLGTKTAFGMTDLEGLDYFGYSDIPFELRLTGADSALWDE
FT                   LVSPMSTGFGPSPSVTTDGDTTVISMGSAGTGRLGDDPVFQETMSGLEKAHLALYMDLR
FT                   AAAEMWEDARPNQWGGLGGALQFQENGSATLNLRWVPSPE"
     MPPGHPAGPP PSHGQPQGPP PGQPQGAPPG QPQGAPPGQP QGVPSGQPQG APSGAALAAP        60
     HGPGGPGFPP SGQPMHSGPG GPPPRKKPVW LIPLSIVLAV ALIGGGVWAS VALVNNLFGG       120
     AQPESVLPRS SAVFAKLDLK PTGQQWASYA QFYERLPDTL KDEFESAEDD FGEELFEELF       180
     PNVELDYASE VEPWLGQRFG VAVWAGNEEP LYAIALAVED EELAEETLTR IQSEDDTLFF       240
     EVVDGFAILT DSQDALNDRR FLVENEGTLE DNEDFADDIS DIGRGIATAW IDYGAIVHNE       300
     VLAADADLED LAELGQVTGR LVAVVRMESK YLEFQANLVN AALDGNTIFA ESVPTGGITA       360
     LHDLPDNSVI ALGGDGLDAV AQAFWEANQG SIESSEDYEE FDSAMRELGV RLPADFHKLL       420
     GTKTAFGMTD LEGLDYFGYS DIPFELRLTG ADSALWDELV SPMSTGFGPS PSVTTDGDTT       480
     VISMGSAGTG RLGDDPVFQE TMSGLEKAHL ALYMDLRAAA EMWEDARPNQ WGGLGGALQF       540
     QENGSATLNL RWVPSPE                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page