(data stored in ACNUC7421 zone)

EMBL: CP000088.PE463

CP000088.PE463       Location/Qualifiers
FT   CDS             527456..528058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54503"
FT                   /db_xref="GOA:Q47SR4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54503.1"
FT                   /translation="MEKVEKPVRASARGAATRSALLEAASYVFRTSGFDKAGVSEVVAQ
FT                   AGASVGSLYHHFTGKADLYLALYQEFQQRQQERTHQAVVDARAEGENDPRKLMTIAARA
FT                   YLEGCIEERELTRIFYSGDSPPGFEALMRQQLREWTGRNAALFRKADEPVDEALLMIVT
FT                   GSISLAATEVIERDPDEARKLADAVVERLSSLTPRKE"
     MEKVEKPVRA SARGAATRSA LLEAASYVFR TSGFDKAGVS EVVAQAGASV GSLYHHFTGK        60
     ADLYLALYQE FQQRQQERTH QAVVDARAEG ENDPRKLMTI AARAYLEGCI EERELTRIFY       120
     SGDSPPGFEA LMRQQLREWT GRNAALFRKA DEPVDEALLM IVTGSISLAA TEVIERDPDE       180
     ARKLADAVVE RLSSLTPRKE                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page