(data stored in ACNUC7421 zone)

EMBL: CP000088.PE464

CP000088.PE464       Location/Qualifiers
FT   CDS             528121..528693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0466"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54504"
FT                   /db_xref="GOA:Q47SR3"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54504.1"
FT                   /translation="MSSGSRRSDNTFLGYAIVLGALIALVVLITVVVDSGRSEQIPTVD
FT                   YTPDALTLSEIAPYQAYAPDQDQLPEGWTPTSSRLNDGGALTEEEPTEPVRWSVGFATP
FT                   EDRHAAFHISDADPDAFIAEVTMRGEPDGESTINGQVWERRYNEVEDERSLVLRTDDAT
FT                   LIVSGGASYEELETLAGALEPQTPAQE"
     MSSGSRRSDN TFLGYAIVLG ALIALVVLIT VVVDSGRSEQ IPTVDYTPDA LTLSEIAPYQ        60
     AYAPDQDQLP EGWTPTSSRL NDGGALTEEE PTEPVRWSVG FATPEDRHAA FHISDADPDA       120
     FIAEVTMRGE PDGESTINGQ VWERRYNEVE DERSLVLRTD DATLIVSGGA SYEELETLAG       180
     ALEPQTPAQE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page