(data stored in ACNUC7421 zone)

EMBL: CP000088.PE467

CP000088.PE467       Location/Qualifiers
FT   CDS             complement(530529..531359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54507"
FT                   /db_xref="GOA:Q47SR0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SR0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54507.1"
FT                   /translation="MGKALVLGGGGIVGLAWEIGVLTGLRDAGVDLRDADVILGTSTGA
FT                   IAAAQIVSGVALDELYERQLAPAGAEAAARPHWWVRARVAGTLLTARSPRLGRARVGLI
FT                   AASSARFSQAVREPLLAAHLPARDWPESTHLVVTAVDARSGAVRAFSRTDGVDLLHAVA
FT                   ASSAVPGLWPPVAVDGRWYIDGGVRSATNADLVAGHERVVVVAPSPRGPLLWRQPVTVP
FT                   FPEGTQCTWVTPSPESRAAFGRDLFNPARRAAAARAGRDQAAEVAVRVARTWGV"
     MGKALVLGGG GIVGLAWEIG VLTGLRDAGV DLRDADVILG TSTGAIAAAQ IVSGVALDEL        60
     YERQLAPAGA EAAARPHWWV RARVAGTLLT ARSPRLGRAR VGLIAASSAR FSQAVREPLL       120
     AAHLPARDWP ESTHLVVTAV DARSGAVRAF SRTDGVDLLH AVAASSAVPG LWPPVAVDGR       180
     WYIDGGVRSA TNADLVAGHE RVVVVAPSPR GPLLWRQPVT VPFPEGTQCT WVTPSPESRA       240
     AFGRDLFNPA RRAAAARAGR DQAAEVAVRV ARTWGV                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page