(data stored in ACNUC7421 zone)

EMBL: CP000088.PE47

CP000088.PE47        Location/Qualifiers
FT   CDS             complement(53440..53640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54087"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54087.1"
FT                   /translation="MCEGERTEVDYLKGITSFFGALPVEVEAVGLGRDPLQVVQEAIDR
FT                   FHEARVNARRTKDANLAFDEV"
     MCEGERTEVD YLKGITSFFG ALPVEVEAVG LGRDPLQVVQ EAIDRFHEAR VNARRTKDAN        60
     LAFDEV                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page