(data stored in ACNUC7421 zone)

EMBL: CP000088.PE472

CP000088.PE472       Location/Qualifiers
FT   CDS             535887..536870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54512"
FT                   /db_xref="GOA:Q47SQ5"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SQ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54512.1"
FT                   /translation="MAGRSAAGRGSVIDEDAPAEADETFDAAPQPGGGRRPRAGAGGRW
FT                   WLWVGRAVLWAFIIVVIVNGVWLPIRENFFPQSTQQPVGEDTVEFPETAAASLAVRFAD
FT                   AYLNADPEKASERAEALAQFVPEGRVTAFDLPGAQLSATGIEVITVEVKDEHNALVRLA
FT                   VNVNGEPMTLDVPVYAADSEGTALVVSGRPALLAAPEKASLPDTSFATDSEARAELEPI
FT                   LKGFFEAYAHNHEHLDRYLEPGAEVTALPGDFLRFGKITDTKVPPAVPGATQDVRVAQV
FT                   TVVWLIPDGSGGDTTAELTQSYDVTVVGDDGSWYVRDIRGALNSFD"
     MAGRSAAGRG SVIDEDAPAE ADETFDAAPQ PGGGRRPRAG AGGRWWLWVG RAVLWAFIIV        60
     VIVNGVWLPI RENFFPQSTQ QPVGEDTVEF PETAAASLAV RFADAYLNAD PEKASERAEA       120
     LAQFVPEGRV TAFDLPGAQL SATGIEVITV EVKDEHNALV RLAVNVNGEP MTLDVPVYAA       180
     DSEGTALVVS GRPALLAAPE KASLPDTSFA TDSEARAELE PILKGFFEAY AHNHEHLDRY       240
     LEPGAEVTAL PGDFLRFGKI TDTKVPPAVP GATQDVRVAQ VTVVWLIPDG SGGDTTAELT       300
     QSYDVTVVGD DGSWYVRDIR GALNSFD                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page