(data stored in ACNUC7421 zone)

EMBL: CP000088.PE488

CP000088.PE488       Location/Qualifiers
FT   CDS             complement(558248..558499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54528"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54528.1"
FT                   /translation="MGYVARFTHAITKDDVGQRVTVRFRLPDGRFRDIVGVLESWHDDV
FT                   LVLRRRDGSLAHVTAAEIVASKVVPPQPPRRSGAPGSA"
     MGYVARFTHA ITKDDVGQRV TVRFRLPDGR FRDIVGVLES WHDDVLVLRR RDGSLAHVTA        60
     AEIVASKVVP PQPPRRSGAP GSA                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page