(data stored in ACNUC7421 zone)

EMBL: CP000088.PE497

CP000088.PE497       Location/Qualifiers
FT   CDS             565929..566507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54537"
FT                   /db_xref="GOA:Q47SN0"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SN0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54537.1"
FT                   /translation="MTAPPESERSARPSAASPIRAMSLWPPPRSARHNNRRPKLPLILG
FT                   VGVGVVVLAVMVGSLLWGEEEPEPEEPPAVVTDGIPEEYAGSWSGEMSQHDEEGNLVAD
FT                   WVVQLKLDAGTDRGSAELLPFHCRGSIVLTEQTAESLVFDYAETYDPEDRCIDTSMLTL
FT                   TQRVPGTLEATWEGISREGTVMTSTGTLK"
     MTAPPESERS ARPSAASPIR AMSLWPPPRS ARHNNRRPKL PLILGVGVGV VVLAVMVGSL        60
     LWGEEEPEPE EPPAVVTDGI PEEYAGSWSG EMSQHDEEGN LVADWVVQLK LDAGTDRGSA       120
     ELLPFHCRGS IVLTEQTAES LVFDYAETYD PEDRCIDTSM LTLTQRVPGT LEATWEGISR       180
     EGTVMTSTGT LK                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page