(data stored in ACNUC7421 zone)

EMBL: CP000088.PE498

CP000088.PE498       Location/Qualifiers
FT   CDS             566517..567989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0500"
FT                   /product="Tyrosine protein kinase:Serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54538"
FT                   /db_xref="GOA:Q47SM9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54538.1"
FT                   /translation="MPAASQDNDGGPSQSGGPMADPAPLIDTDPARIGEYTLLGRLGQG
FT                   GQGVVYLGSAPDGARVAVKTLHRDALDLPGLREQLAEEVEMARRVARFCTAQVLAADLD
FT                   ADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAVGTLTALAAIHQAGIVHRDFKPAN
FT                   VLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLGPAVDMFAWGATL
FT                   VYAANGRGPFGHGSLKAVVQRVINDEPDFGELSGTLREIAERCLNKDAAQRPTAAETLM
FT                   LVLGIEGPPPTEEPSTDTAIPVTHQTLVAGAIAAADTGEQESAAELYRSYPPAPPPPHS
FT                   NVAAQPSPTPPPHPQTASGPQPSLPSTGAQHSGYGYATGPHQSGYGYATGPQQGGYAPP
FT                   PGPHQHAYPTPHSGNAAIPPHGGPSGPYAPAQPWMPSTGGYPQTSQPYSGQQYQQQAEG
FT                   TSTAFVLGVVSIAVIAGVLLFILLFLLIGSLG"
     MPAASQDNDG GPSQSGGPMA DPAPLIDTDP ARIGEYTLLG RLGQGGQGVV YLGSAPDGAR        60
     VAVKTLHRDA LDLPGLREQL AEEVEMARRV ARFCTAQVLA ADLDADPPYV VSEYVEGPSL       120
     QAVVRERGPL RGASLERLAV GTLTALAAIH QAGIVHRDFK PANVLMAPGG PRVIDFGIAR       180
     ALEGTAILTS RIAGTPAYMA PEQITGGPLG PAVDMFAWGA TLVYAANGRG PFGHGSLKAV       240
     VQRVINDEPD FGELSGTLRE IAERCLNKDA AQRPTAAETL MLVLGIEGPP PTEEPSTDTA       300
     IPVTHQTLVA GAIAAADTGE QESAAELYRS YPPAPPPPHS NVAAQPSPTP PPHPQTASGP       360
     QPSLPSTGAQ HSGYGYATGP HQSGYGYATG PQQGGYAPPP GPHQHAYPTP HSGNAAIPPH       420
     GGPSGPYAPA QPWMPSTGGY PQTSQPYSGQ QYQQQAEGTS TAFVLGVVSI AVIAGVLLFI       480
     LLFLLIGSLG                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page