(data stored in ACNUC7421 zone)

EMBL: CP000088.PE507

CP000088.PE507       Location/Qualifiers
FT   CDS             576351..577511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54547"
FT                   /db_xref="GOA:Q47SM0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SM0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54547.1"
FT                   /translation="MGNVPPPWPSGPDPRERAVPQHSQVWASPGQAAHPGGPDAVWAWP
FT                   PPVKPPRPRVDTPPPGVPYHRMGRTERHRWWKPPLAIGCAIPLSFGLGLFFVLVLELVK
FT                   AIRHIPADVAELGHPVADLAVELVLVIVLLPAVLIAVRVVQRRRAGTLSSVEGRLRWRW
FT                   LLRCTAVAVGCVVVSFGGLMALLVITKPGEPLFGEFAGMETFLAALAVIFLLVPFQAAA
FT                   EEYALRGFLMQLVGGYGDPTRPGRSAPGRLFHRFLASPVPAILVSGLIFTLLHDYYDWA
FT                   LLDVAVFGLGMAWLTWYTGGLEAAIALHVVHNLVAFVLAAYEGDFDSSGDTGSWQSLLA
FT                   TIVEVSVFCLVVAWMRRKQAIRHTTPEAEATPPARPQSPPPSPQWS"
     MGNVPPPWPS GPDPRERAVP QHSQVWASPG QAAHPGGPDA VWAWPPPVKP PRPRVDTPPP        60
     GVPYHRMGRT ERHRWWKPPL AIGCAIPLSF GLGLFFVLVL ELVKAIRHIP ADVAELGHPV       120
     ADLAVELVLV IVLLPAVLIA VRVVQRRRAG TLSSVEGRLR WRWLLRCTAV AVGCVVVSFG       180
     GLMALLVITK PGEPLFGEFA GMETFLAALA VIFLLVPFQA AAEEYALRGF LMQLVGGYGD       240
     PTRPGRSAPG RLFHRFLASP VPAILVSGLI FTLLHDYYDW ALLDVAVFGL GMAWLTWYTG       300
     GLEAAIALHV VHNLVAFVLA AYEGDFDSSG DTGSWQSLLA TIVEVSVFCL VVAWMRRKQA       360
     IRHTTPEAEA TPPARPQSPP PSPQWS                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page