(data stored in ACNUC7421 zone)

EMBL: CP000088.PE51

CP000088.PE51        Location/Qualifiers
FT   CDS             59730..60761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54091"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54091.1"
FT                   /translation="MTVHIAPVGLSIIGNLAKIEKLKFVEEPAGPNPIEQDFPWTELIK
FT                   QVQASGYLESIYPGKKPKDVMEAMFETGSAADSPERDELQEIADRINVGEWIRYRGVSA
FT                   ELDTLRQAAIEISSAKKKEEFLPSRKDTVFLLATDTDKGIAAAWWNAIALANGDIRRIR
FT                   YLSDLDENARLDKTAIGCIHILRIPGLDAFSSDQAFREPMKIMGRLGRLLVAPPESMLE
FT                   KVKRIIQPREEIRFYLSGGYKATIPYLVALAEWVRSLGEDVSAWIMHETSRKPFQLPLR
FT                   RLEVRQVRHELKPFYKDGKTKNLETNFFEGYAYEIRGKEYRLTAFGQGMCELFGIPTES
FT                   VPQ"
     MTVHIAPVGL SIIGNLAKIE KLKFVEEPAG PNPIEQDFPW TELIKQVQAS GYLESIYPGK        60
     KPKDVMEAMF ETGSAADSPE RDELQEIADR INVGEWIRYR GVSAELDTLR QAAIEISSAK       120
     KKEEFLPSRK DTVFLLATDT DKGIAAAWWN AIALANGDIR RIRYLSDLDE NARLDKTAIG       180
     CIHILRIPGL DAFSSDQAFR EPMKIMGRLG RLLVAPPESM LEKVKRIIQP REEIRFYLSG       240
     GYKATIPYLV ALAEWVRSLG EDVSAWIMHE TSRKPFQLPL RRLEVRQVRH ELKPFYKDGK       300
     TKNLETNFFE GYAYEIRGKE YRLTAFGQGM CELFGIPTES VPQ                         343
//

If you have problems or comments...

PBIL Back to PBIL home page