(data stored in ACNUC7421 zone)

EMBL: CP000088.PE515

CP000088.PE515       Location/Qualifiers
FT   CDS             complement(584559..585386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54555"
FT                   /db_xref="GOA:Q47SL2"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SL2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54555.1"
FT                   /translation="MFTPLAVTDIGQGIGSVWGSLVAFIPRLAVFLVVLILGWLLAKLI
FT                   GRLVAKALAKVGLDRALERGGLGSYFQRSRFNASDIAGKFVYYAGVLIVLQLAFSVFGP
FT                   NNPITQMLNSVVAWLPHLAVALIIVVVAALIARAVRELASEALGGLSYGKVLANTAGVF
FT                   IVGLGIIAALNQIGVAAAVTLPILIAVLAAVAGILIVGVGGGLIRPMQQRWEGWLDRAE
FT                   SETKNFRAQGAGDRGPATAGSRSTETVAPPRQESAPGEPLASSGERRRRHRRP"
     MFTPLAVTDI GQGIGSVWGS LVAFIPRLAV FLVVLILGWL LAKLIGRLVA KALAKVGLDR        60
     ALERGGLGSY FQRSRFNASD IAGKFVYYAG VLIVLQLAFS VFGPNNPITQ MLNSVVAWLP       120
     HLAVALIIVV VAALIARAVR ELASEALGGL SYGKVLANTA GVFIVGLGII AALNQIGVAA       180
     AVTLPILIAV LAAVAGILIV GVGGGLIRPM QQRWEGWLDR AESETKNFRA QGAGDRGPAT       240
     AGSRSTETVA PPRQESAPGE PLASSGERRR RHRRP                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page