(data stored in ACNUC7421 zone)

EMBL: CP000088.PE519

CP000088.PE519       Location/Qualifiers
FT   CDS             588077..588472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54559"
FT                   /db_xref="GOA:Q47SK8"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54559.1"
FT                   /translation="MGGQWDNWVALAAGIVVGLSWVWHGLFGLGMVVLFLLGLATVLTA
FT                   VLSLTRPGMLSSEAVLIGIGVLLVLTPWLFGFTGNLAAAWTAWVAGVVIAVTGAVGLVR
FT                   SWRSHGTQEPRGPSGSATRSPTMRALT"
     MGGQWDNWVA LAAGIVVGLS WVWHGLFGLG MVVLFLLGLA TVLTAVLSLT RPGMLSSEAV        60
     LIGIGVLLVL TPWLFGFTGN LAAAWTAWVA GVVIAVTGAV GLVRSWRSHG TQEPRGPSGS       120
     ATRSPTMRAL T                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page