(data stored in ACNUC7421 zone)

EMBL: CP000088.PE527

CP000088.PE527       Location/Qualifiers
FT   CDS             complement(600309..600569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0529"
FT                   /product="Glutaredoxin-like protein GlrX"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54567"
FT                   /db_xref="GOA:Q47SK0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011915"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54567.1"
FT                   /translation="MATSTGAQITMYTTPWCGFCKRLKSQLDREGIPVVEVDIERDPKA
FT                   AEFVMQVNGGNQTVPTVVFADGTALTNPSLAEVKQKLAAQS"
     MATSTGAQIT MYTTPWCGFC KRLKSQLDRE GIPVVEVDIE RDPKAAEFVM QVNGGNQTVP        60
     TVVFADGTAL TNPSLAEVKQ KLAAQS                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page