(data stored in ACNUC7421 zone)

EMBL: CP000088.PE53

CP000088.PE53        Location/Qualifiers
FT   CDS             62826..63449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54093"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54093.1"
FT                   /translation="MDAHEWDQRYREQELVWGVEPNRFVVEVVADLPPGRALDVAAGEG
FT                   RNAVWLAEQGWQVTASDFSAVAVERGKKLARERGVEVEWLCADARNPAPRREGYDLVLL
FT                   SYLQLPPGDWRRALTEAVRAVAPRGRLVSVGHALENLTRGVGGPQDPKVLHIPEDIAMA
FT                   VAEIAAGEGFAVQVERAGYVTREVATEEGPRTAVDSLVVVHRSA"
     MDAHEWDQRY REQELVWGVE PNRFVVEVVA DLPPGRALDV AAGEGRNAVW LAEQGWQVTA        60
     SDFSAVAVER GKKLARERGV EVEWLCADAR NPAPRREGYD LVLLSYLQLP PGDWRRALTE       120
     AVRAVAPRGR LVSVGHALEN LTRGVGGPQD PKVLHIPEDI AMAVAEIAAG EGFAVQVERA       180
     GYVTREVATE EGPRTAVDSL VVVHRSA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page