(data stored in ACNUC7421 zone)

EMBL: CP000088.PE530

CP000088.PE530       Location/Qualifiers
FT   CDS             604501..604782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0532"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54570"
FT                   /db_xref="GOA:Q47SJ7"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54570.1"
FT                   /translation="MLASVLGSPWLEGVEIPCRSQPDLFFAESPAEVEAAKALCVDCPV
FT                   REQCLAGALERREPWGVWGGQLLVSGKVVARKRPRGRPRKNQTEPIAA"
     MLASVLGSPW LEGVEIPCRS QPDLFFAESP AEVEAAKALC VDCPVREQCL AGALERREPW        60
     GVWGGQLLVS GKVVARKRPR GRPRKNQTEP IAA                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page