(data stored in ACNUC7421 zone)

EMBL: CP000088.PE534

CP000088.PE534       Location/Qualifiers
FT   CDS             complement(607978..609381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54574"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54574.1"
FT                   /translation="MNDLPFGFSMSNGPDDESGRGPNDSGSGAGQGGSGGGFPHMPPGG
FT                   FPFGDPQQFAQMLRQFADMMSAAQPTSGSGQDSGASGINWAAATNIARHVVSQHGDPSI
FT                   GPVDYARVQEALRLADLWLNEVTALPSGLHTMEAWSRSEWVEKTVPTWTKLCEPLTGRV
FT                   VETMGQNLPQEMAAVAGPLLGMFRQIGGALVGQQVGQAIGELAREVVGSTDVGLPLAGE
FT                   GRAVLLPEGVREFGEGLGVPLDEVRLYLAAREAAHHRLFRHVPWLRSHLFALVEEYAAG
FT                   MSFDISGFEKQLGHIDLTNPESLQEALSSLEGQGLFQTEDTPRQKASLARLETALALIE
FT                   GWVSTVVDAAVSQRLPQAAALGEALRRRRASGGPAEHTFATLVGLELRPRRLRDAAKLW
FT                   QALTEARGIDGRDAVWEHPDLMPSGEDLDAPDDFVRGSASSPDLDLSQLTEEPSEERRD
FT                   GDDEDKGER"
     MNDLPFGFSM SNGPDDESGR GPNDSGSGAG QGGSGGGFPH MPPGGFPFGD PQQFAQMLRQ        60
     FADMMSAAQP TSGSGQDSGA SGINWAAATN IARHVVSQHG DPSIGPVDYA RVQEALRLAD       120
     LWLNEVTALP SGLHTMEAWS RSEWVEKTVP TWTKLCEPLT GRVVETMGQN LPQEMAAVAG       180
     PLLGMFRQIG GALVGQQVGQ AIGELAREVV GSTDVGLPLA GEGRAVLLPE GVREFGEGLG       240
     VPLDEVRLYL AAREAAHHRL FRHVPWLRSH LFALVEEYAA GMSFDISGFE KQLGHIDLTN       300
     PESLQEALSS LEGQGLFQTE DTPRQKASLA RLETALALIE GWVSTVVDAA VSQRLPQAAA       360
     LGEALRRRRA SGGPAEHTFA TLVGLELRPR RLRDAAKLWQ ALTEARGIDG RDAVWEHPDL       420
     MPSGEDLDAP DDFVRGSASS PDLDLSQLTE EPSEERRDGD DEDKGER                     467
//

If you have problems or comments...

PBIL Back to PBIL home page