(data stored in ACNUC7421 zone)

EMBL: CP000088.PE536

CP000088.PE536       Location/Qualifiers
FT   CDS             610631..611062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0538"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54576"
FT                   /db_xref="GOA:Q47SJ1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SJ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54576.1"
FT                   /translation="MEAIALAEIRTTPLSVDEVLAAVKDDRAGGTAFFVGTVRNHDHGR
FT                   DVAALSYSAHPTAEQRMRDVMEKIVADTADGTVHRVAAVHRVGDLTVGDLAVVVAAAAS
FT                   HREEAFTVCRRLIDDIKAEVPIWKHQTFTEGDSEWVGAY"
     MEAIALAEIR TTPLSVDEVL AAVKDDRAGG TAFFVGTVRN HDHGRDVAAL SYSAHPTAEQ        60
     RMRDVMEKIV ADTADGTVHR VAAVHRVGDL TVGDLAVVVA AAASHREEAF TVCRRLIDDI       120
     KAEVPIWKHQ TFTEGDSEWV GAY                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page