(data stored in ACNUC7421 zone)

EMBL: CP000088.PE539

CP000088.PE539       Location/Qualifiers
FT   CDS             613064..616120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54579"
FT                   /db_xref="GOA:Q47SI8"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SI8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54579.1"
FT                   /translation="MSFRSPGAPTARMPRRSRLLAPVGAAVVVIIAGIMFAANFWTEYR
FT                   WFGSVGYTTVFWTELRTRALLFAGGALLMALAVGLSVYFAYRTRPAYRPFSLEQQGLDR
FT                   YRSSIDPHRKVFFWGLVGGLALLTGASATAEWQTFLQFANATKFGAQDAQFGLDISFYT
FT                   FTYPFLQVIIGYLYTAVVIAFIAGVVVHYLYGGVRLQAQGQRVTPAARVHLSVLLGVFL
FT                   LLRAADYWLEQYGLVFSNRGYTFGASYTDVNAVLYAKIILFFIALVCAVLFFANIYFKN
FT                   ARVPLVSLGLMVLSAILIGGVYPAIVQQVTVSPNEQRLERPYIQRNIEATRAAYGIDGA
FT                   EVIDYDAQTELTTAELAAEAETIPSVRLVDPAVVSQTFQQLQQVRGFYQFPQVLEVDRY
FT                   TTSDGETVDTIVAARELDGPPSQEDRWLTRHLVYTHGFGMVAAAGNQVDSEGRPVFLEY
FT                   NIPPTGELSQVGEGYEPRIYFGREGAEYVIVNAEAEYDYPVDPDTPEVPTTEDAVVPTP
FT                   SPSPEADEAPAPADSREEGSAQEQQDQEGQDGGEDAQGTEEEQSGQGSGQANNYYDGKG
FT                   GVQLKSFFDKLMYALKYQEINILLNNAISNESQIIYVRDPAERVEKVAPFLTVDGKAYP
FT                   AVVDGRIVWIVDAYTTSDRYPYSTPIDLAQATTDTFTESTTAVNALPGNRVNYIRNSVK
FT                   ATVDAYDGTVTLYGWDEEDPVLQTWSKAFPGVVTSKDEISDTLLSHLRYPDDLYKVQRE
FT                   ILERYHITNADAFYGGQDFWTVPNDPKPQAGNNPEPPYRQTIRFPGDDTPTYSLTSTFV
FT                   PRGRENLAAFMAVNSDASSEDYGQMRILELPRSTAVQGPGQIQNTFQSSAEVREVLLPL
FT                   EQSSAQVTYGNLLTLPFAGGLLYVEPLYVQAGGSDASYPLLQQVLVGFGDQVAIGSNLQ
FT                   EALNNLFDGDEAPLEEPTTDGEAREEEEQPQASSDLAQALEDAAEAYEEGQAALREGDF
FT                   AAYGEANERLKEALDRAKAASGSNEEKDE"
     MSFRSPGAPT ARMPRRSRLL APVGAAVVVI IAGIMFAANF WTEYRWFGSV GYTTVFWTEL        60
     RTRALLFAGG ALLMALAVGL SVYFAYRTRP AYRPFSLEQQ GLDRYRSSID PHRKVFFWGL       120
     VGGLALLTGA SATAEWQTFL QFANATKFGA QDAQFGLDIS FYTFTYPFLQ VIIGYLYTAV       180
     VIAFIAGVVV HYLYGGVRLQ AQGQRVTPAA RVHLSVLLGV FLLLRAADYW LEQYGLVFSN       240
     RGYTFGASYT DVNAVLYAKI ILFFIALVCA VLFFANIYFK NARVPLVSLG LMVLSAILIG       300
     GVYPAIVQQV TVSPNEQRLE RPYIQRNIEA TRAAYGIDGA EVIDYDAQTE LTTAELAAEA       360
     ETIPSVRLVD PAVVSQTFQQ LQQVRGFYQF PQVLEVDRYT TSDGETVDTI VAARELDGPP       420
     SQEDRWLTRH LVYTHGFGMV AAAGNQVDSE GRPVFLEYNI PPTGELSQVG EGYEPRIYFG       480
     REGAEYVIVN AEAEYDYPVD PDTPEVPTTE DAVVPTPSPS PEADEAPAPA DSREEGSAQE       540
     QQDQEGQDGG EDAQGTEEEQ SGQGSGQANN YYDGKGGVQL KSFFDKLMYA LKYQEINILL       600
     NNAISNESQI IYVRDPAERV EKVAPFLTVD GKAYPAVVDG RIVWIVDAYT TSDRYPYSTP       660
     IDLAQATTDT FTESTTAVNA LPGNRVNYIR NSVKATVDAY DGTVTLYGWD EEDPVLQTWS       720
     KAFPGVVTSK DEISDTLLSH LRYPDDLYKV QREILERYHI TNADAFYGGQ DFWTVPNDPK       780
     PQAGNNPEPP YRQTIRFPGD DTPTYSLTST FVPRGRENLA AFMAVNSDAS SEDYGQMRIL       840
     ELPRSTAVQG PGQIQNTFQS SAEVREVLLP LEQSSAQVTY GNLLTLPFAG GLLYVEPLYV       900
     QAGGSDASYP LLQQVLVGFG DQVAIGSNLQ EALNNLFDGD EAPLEEPTTD GEAREEEEQP       960
     QASSDLAQAL EDAAEAYEEG QAALREGDFA AYGEANERLK EALDRAKAAS GSNEEKDE        1018
//

If you have problems or comments...

PBIL Back to PBIL home page