(data stored in ACNUC7421 zone)

EMBL: CP000088.PE551

CP000088.PE551       Location/Qualifiers
FT   CDS             complement(628267..629928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0553"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54591"
FT                   /db_xref="GOA:Q47SH6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54591.1"
FT                   /translation="MGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGA
FT                   VKADPPMRLLDVRHEQTAVFAAEAVGKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSP
FT                   LVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWTVHDTAQIGPALDEAFTLANTAHR
FT                   GPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAERPVLVYGSDVWL
FT                   DHAEQAALEAAEELGVPVVTNGQGRGVLPAGHPLLATRARGLALGRADLVIVVGTPLDF
FT                   RLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREV
FT                   AQWRTEVAEAAAATAAKDREVLDSDASPIHPARIYGELNRILDDDAVVIGDGGDFVSYA
FT                   GKYIQPRRPGNWLDPGPFGCLGTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTL
FT                   VRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDVLADLAPQTRYDQVVTALGGGGELVTDP
FT                   AEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGV"
     MGSPSFSGKL TGHGGNHAVE VARHHGVDTL FTLSGGHIFP IYDGAVKADP PMRLLDVRHE        60
     QTAVFAAEAV GKLTRRAGWA ALTAGPGVTN GVSGIATAHF NGSPLVVVGG RAPDNRWGQG       120
     LLQELDQSPL FTTITKRAWT VHDTAQIGPA LDEAFTLANT AHRGPVFLDI PMDRLYDQAE       180
     ITVTGQAAAE DRSPDPDAVA AVARLLSEAE RPVLVYGSDV WLDHAEQAAL EAAEELGVPV       240
     VTNGQGRGVL PAGHPLLATR ARGLALGRAD LVIVVGTPLD FRLNHGLFGG RDGAPLARTV       300
     HITDSPAQLA THLTLAGAVS GDLSAILRAL AEQAKPKREV AQWRTEVAEA AAATAAKDRE       360
     VLDSDASPIH PARIYGELNR ILDDDAVVIG DGGDFVSYAG KYIQPRRPGN WLDPGPFGCL       420
     GTGMGYAIAA RLVRPSSQVV ALFGDGALGF SLADVDTLVR HNLPVVMVCG NNGIWGLEKA       480
     PMQLVYGYDV LADLAPQTRY DQVVTALGGG GELVTDPAEI GPALRRAFDS GVPYLVNIVT       540
     DPENVYPRKT MGV                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page