(data stored in ACNUC7421 zone)

EMBL: CP000088.PE555

CP000088.PE555       Location/Qualifiers
FT   CDS             complement(633163..634098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0557"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54595"
FT                   /db_xref="GOA:Q47SH2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SH2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54595.1"
FT                   /translation="MRALFIGNPQATTATPRSRDVIVRALASDMAVDTVLTEYRGHARE
FT                   LVQRAAEEGYDLVVSFGGDGTVNEVVNGILALPAKQRPLYAALPGGSANVFVRALGLPA
FT                   NPVEATGAVLEALHSGSRRTVNLGHIDGPDGGRYFTFCAGFGWDAEVVHEVERQRQRGR
FT                   RATPALYTAIALSLFLRGGMGGDPSLSVEVPGRPPVRNLFFVLVTNTTPWTYAGPSPVQ
FT                   PTPRSRFELDLDVFALTRVDTITTANVLRMMFSAKGVPPRGRGYRTWHNCAEFTIRSQH
FT                   PRPFQIDGEYLGHRQQVNFRSVPKALRIVA"
     MRALFIGNPQ ATTATPRSRD VIVRALASDM AVDTVLTEYR GHARELVQRA AEEGYDLVVS        60
     FGGDGTVNEV VNGILALPAK QRPLYAALPG GSANVFVRAL GLPANPVEAT GAVLEALHSG       120
     SRRTVNLGHI DGPDGGRYFT FCAGFGWDAE VVHEVERQRQ RGRRATPALY TAIALSLFLR       180
     GGMGGDPSLS VEVPGRPPVR NLFFVLVTNT TPWTYAGPSP VQPTPRSRFE LDLDVFALTR       240
     VDTITTANVL RMMFSAKGVP PRGRGYRTWH NCAEFTIRSQ HPRPFQIDGE YLGHRQQVNF       300
     RSVPKALRIV A                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page