(data stored in ACNUC7421 zone)

EMBL: CP000088.PE567

CP000088.PE567       Location/Qualifiers
FT   CDS             646664..647296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54607"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54607.1"
FT                   /translation="MTTPMPDHLLRVAENTKGFMPTDEGLVLYETALAYAPLGPVLEIG
FT                   TYCGKSTVFLGAAVQQVGGVVITVDHHHGSEEHQVGWEYHDPSLVNPTTGKLDTLGAFR
FT                   ETMAAADLEDHVIAIVGHSAAVARLWNTPLGMVFIDGSHTEEAAQADYTGWSPHVCVGG
FT                   ALVIHDVFPNPADGGRPPYHIYRRALESGEFVEERAHGSLRVLRRKR"
     MTTPMPDHLL RVAENTKGFM PTDEGLVLYE TALAYAPLGP VLEIGTYCGK STVFLGAAVQ        60
     QVGGVVITVD HHHGSEEHQV GWEYHDPSLV NPTTGKLDTL GAFRETMAAA DLEDHVIAIV       120
     GHSAAVARLW NTPLGMVFID GSHTEEAAQA DYTGWSPHVC VGGALVIHDV FPNPADGGRP       180
     PYHIYRRALE SGEFVEERAH GSLRVLRRKR                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page