(data stored in ACNUC7421 zone)

EMBL: CP000088.PE568

CP000088.PE568       Location/Qualifiers
FT   CDS             647955..651344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0570"
FT                   /product="similar to Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54608"
FT                   /db_xref="GOA:Q47SF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54608.1"
FT                   /translation="MPGGDELSESSRGDTTPRPETEEATVADSSVTNDDVSVDESGVDA
FT                   RADDVDDGSEPEWFASAGESPYLEASAFKDSGSFFRDKVARSLAEEYGIDLDDAGDQTA
FT                   DSAASSGADGQQAQDADTHAGTASPAEDTDQAAAAAAGAEEDEEATEQLRPADAVGGDS
FT                   GGLDEATVQITPTDAADASAVDEEGTTERLSPPSSSGPGADDEATEQINLPSSAAADDE
FT                   ETTERLSPSAARAGDDEATERLDVPASSTAVDAEEATEQLRPADAVGGDSGGLDEATVQ
FT                   IAPVGAVDAEETTERLSPSAARAGDDEATERLDVPASSATVDAEETTERISPVTPTGHG
FT                   SGEETTVQLSPVEAAQSQAAPSTTDPSESTKLETTAVLRENLKSRLRKRPLRPRFRKSA
FT                   AAAGGVGPASPPPPTAPSGTSHSSGPAEKKAPAKKTKRKKPLWWRITRAGLIVIVLLVG
FT                   LVTGAFAYAYSMFEVPDAAQADATAQGSIFYYADGSVLTERGVNRKPVSLDEVPEHVQN
FT                   AILSAENRGFWDEPGVSITGTARAVWSTVTGKQLQGGSTITQQFVRNYYEGLSQEQTIE
FT                   RKLKEIIIALKVDRSQSKEWILEQYLNTIYFGRNAYGIQAAAEAYYDKDVGDLTPDEAA
FT                   FLAAAIQQPTKFGFADSDTTPEMESRWQYVVNGLVDMGSITEAEAAEYKFPKPLPERPQ
FT                   DNIDLSGYKGYMFQQAMKELEELGYTEDNINRGGYEIHTTFDPKLMELAYEAVQETVPI
FT                   DDLPEGVRVGLSVVDPKTGGVLAFYGGEDYFENQYDSAFLGTAQAGSAMKPYVLAAALK
FT                   EGLSLHTVVDGRGPRYINGTRIQNAGNAPGGPMNLIQATAVSNNLGYIDLAQRVGLEKV
FT                   AETAYAMGLPEGSIDLVPVLPLGANSVSPTDQAGGYATFANGGEHIETHVVASIINKEG
FT                   EEERPEPKRNRVLTKEQAADATYAMRQVITSGTGTAANIGRPAAGKTGTTDGSVAAWFV
FT                   GYTPQLSAAVGIYSGDNQRFYVPGWGTLSGGTLPATVWRTFMQKALADKPVEDFPSPSF
FT                   GGSAQNWAPQPEPSTPADTPQDQGPNQDGLNPAPEPEVPQPAPEPVVPEPVVPEPVVPE
FT                   PVVPEPGGPDPGFPGGGLPPSG"
     MPGGDELSES SRGDTTPRPE TEEATVADSS VTNDDVSVDE SGVDARADDV DDGSEPEWFA        60
     SAGESPYLEA SAFKDSGSFF RDKVARSLAE EYGIDLDDAG DQTADSAASS GADGQQAQDA       120
     DTHAGTASPA EDTDQAAAAA AGAEEDEEAT EQLRPADAVG GDSGGLDEAT VQITPTDAAD       180
     ASAVDEEGTT ERLSPPSSSG PGADDEATEQ INLPSSAAAD DEETTERLSP SAARAGDDEA       240
     TERLDVPASS TAVDAEEATE QLRPADAVGG DSGGLDEATV QIAPVGAVDA EETTERLSPS       300
     AARAGDDEAT ERLDVPASSA TVDAEETTER ISPVTPTGHG SGEETTVQLS PVEAAQSQAA       360
     PSTTDPSEST KLETTAVLRE NLKSRLRKRP LRPRFRKSAA AAGGVGPASP PPPTAPSGTS       420
     HSSGPAEKKA PAKKTKRKKP LWWRITRAGL IVIVLLVGLV TGAFAYAYSM FEVPDAAQAD       480
     ATAQGSIFYY ADGSVLTERG VNRKPVSLDE VPEHVQNAIL SAENRGFWDE PGVSITGTAR       540
     AVWSTVTGKQ LQGGSTITQQ FVRNYYEGLS QEQTIERKLK EIIIALKVDR SQSKEWILEQ       600
     YLNTIYFGRN AYGIQAAAEA YYDKDVGDLT PDEAAFLAAA IQQPTKFGFA DSDTTPEMES       660
     RWQYVVNGLV DMGSITEAEA AEYKFPKPLP ERPQDNIDLS GYKGYMFQQA MKELEELGYT       720
     EDNINRGGYE IHTTFDPKLM ELAYEAVQET VPIDDLPEGV RVGLSVVDPK TGGVLAFYGG       780
     EDYFENQYDS AFLGTAQAGS AMKPYVLAAA LKEGLSLHTV VDGRGPRYIN GTRIQNAGNA       840
     PGGPMNLIQA TAVSNNLGYI DLAQRVGLEK VAETAYAMGL PEGSIDLVPV LPLGANSVSP       900
     TDQAGGYATF ANGGEHIETH VVASIINKEG EEERPEPKRN RVLTKEQAAD ATYAMRQVIT       960
     SGTGTAANIG RPAAGKTGTT DGSVAAWFVG YTPQLSAAVG IYSGDNQRFY VPGWGTLSGG      1020
     TLPATVWRTF MQKALADKPV EDFPSPSFGG SAQNWAPQPE PSTPADTPQD QGPNQDGLNP      1080
     APEPEVPQPA PEPVVPEPVV PEPVVPEPVV PEPGGPDPGF PGGGLPPSG                  1129
//

If you have problems or comments...

PBIL Back to PBIL home page