(data stored in ACNUC7421 zone)

EMBL: CP000088.PE577

CP000088.PE577       Location/Qualifiers
FT   CDS             complement(659783..661492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0579"
FT                   /product="signal peptide peptidase A. Serine peptidase.
FT                   MEROPS family S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54617"
FT                   /db_xref="GOA:Q47SF0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SF0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54617.1"
FT                   /translation="MDAAKLFDPLTTIRRRRTAPLVLELDLTEGMIDEPPGDPLSQIMA
FT                   MRRQRLFDIVEGIRRGAHDPRVKALIVKIGSQSLGMALVQELRQAVAMFRRAGKHTVAW
FT                   SESFGEFGPGSLPYYLATAFDEIALLPSGSVGLTGLRVENLFFAEALEKLGVDYQGGAR
FT                   HEYKTALNMFTERGFTDAHREASGRIVESLTEQLVAGISSGRDLSEERVRELIDQGPFL
FT                   ATEAVEAGLVDKVAYRDEIYSDLLDRYSADGTPAHLQYVSRYQRTRSLADRVPVAQRSG
FT                   YVALISGVGQIVTGRSRRSPLGGGAVMGSDTVAAAFRAARKDPNVRAVVFRVNSPGGSY
FT                   TASDVIWREVVLTSQAGTPVVVSMGDVAGSGGYFIAAGADVIIAQPGTITGSIGVVVGK
FT                   AVLSTMLAKLGVTSDWIDSGNHAGMFSPNRPFSESEWERVNTMLDHIYDDFVGKVAEGR
FT                   KMTRDQVHEVAKGRIWTGQDACERGLVDEVGGLETAIRIARDRGGLPPSAPVRHFPQLG
FT                   PLERLIPAESSEDRTAQAQLRLSGWGPLAELSARLGLPAAGPLVMPGTWEIR"
     MDAAKLFDPL TTIRRRRTAP LVLELDLTEG MIDEPPGDPL SQIMAMRRQR LFDIVEGIRR        60
     GAHDPRVKAL IVKIGSQSLG MALVQELRQA VAMFRRAGKH TVAWSESFGE FGPGSLPYYL       120
     ATAFDEIALL PSGSVGLTGL RVENLFFAEA LEKLGVDYQG GARHEYKTAL NMFTERGFTD       180
     AHREASGRIV ESLTEQLVAG ISSGRDLSEE RVRELIDQGP FLATEAVEAG LVDKVAYRDE       240
     IYSDLLDRYS ADGTPAHLQY VSRYQRTRSL ADRVPVAQRS GYVALISGVG QIVTGRSRRS       300
     PLGGGAVMGS DTVAAAFRAA RKDPNVRAVV FRVNSPGGSY TASDVIWREV VLTSQAGTPV       360
     VVSMGDVAGS GGYFIAAGAD VIIAQPGTIT GSIGVVVGKA VLSTMLAKLG VTSDWIDSGN       420
     HAGMFSPNRP FSESEWERVN TMLDHIYDDF VGKVAEGRKM TRDQVHEVAK GRIWTGQDAC       480
     ERGLVDEVGG LETAIRIARD RGGLPPSAPV RHFPQLGPLE RLIPAESSED RTAQAQLRLS       540
     GWGPLAELSA RLGLPAAGPL VMPGTWEIR                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page