(data stored in ACNUC7421 zone)

EMBL: CP000088.PE579

CP000088.PE579       Location/Qualifiers
FT   CDS             662881..663678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54619"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54619.1"
FT                   /translation="MSGIPSRSRFEAPRRRLPVRLMAALAAGALAMTGCSDDSDSASSE
FT                   RPPVPEPEATYGGVLEAAEAPAPAGFTQLNIEGVKINAPQGWEVDQGEGMLCMRPPGQD
FT                   TCGYGAVEVRPKAAQRHPDNWPKRDSSFHKDDGWAADPTTCRSLTTAEAGNVGIKESTL
FT                   HLIGDGLTTHADGLKSHYSTWKVTCENDDTFEVRLWFLPESDVLVYVWSVDQRYDSLYL
FT                   TIAESMDVTEYKQRIREEEERRNRDRDRDNDRDQDQGDNQDDD"
     MSGIPSRSRF EAPRRRLPVR LMAALAAGAL AMTGCSDDSD SASSERPPVP EPEATYGGVL        60
     EAAEAPAPAG FTQLNIEGVK INAPQGWEVD QGEGMLCMRP PGQDTCGYGA VEVRPKAAQR       120
     HPDNWPKRDS SFHKDDGWAA DPTTCRSLTT AEAGNVGIKE STLHLIGDGL TTHADGLKSH       180
     YSTWKVTCEN DDTFEVRLWF LPESDVLVYV WSVDQRYDSL YLTIAESMDV TEYKQRIREE       240
     EERRNRDRDR DNDRDQDQGD NQDDD                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page