(data stored in ACNUC7421 zone)

EMBL: CP000088.PE58

CP000088.PE58        Location/Qualifiers
FT   CDS             70512..71909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0060"
FT                   /product="putative oxidoreductase, oxygen dependent,
FT                   FAD-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54098"
FT                   /db_xref="GOA:Q47TW6"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q47TW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54098.1"
FT                   /translation="MAQLNSTTVTGTAVAEFRSEFAGQVLEPGDSGYDQARTVVNPLVD
FT                   LRPRVIAQCETVDDVVRAVRFGREHDLEIAVRGGGHGVGGEALTDGGIVIDLRRMSEVT
FT                   VNPEEANARVSGGATMGHLDRAAQPYGLATTGGRVSTIGVCGLVLNGGSGWLDRRFGLA
FT                   CDNLLAAELVTADGDVVRASPEENPELFWALHGGGGNFGVVTSMTLRLHELPSVNVSLL
FT                   LWDAEAGPDVVRAYREFMGASTDDVCGGLMYMTAPSEDFVPLWLVGRLVCAVLLIHTGR
FT                   DPDEVARDLQPMREAGHVAEISAEMAYADVQCLLDGPPGYHTYWSAEHVTTLPDEAVDR
FT                   YCAGAQRMPAPSPSQYLLAPQGGTVSRALTDYPIPWRYAAWGVYPFGVWRDAADEERVV
FT                   QWAQSVRAEMSPWATGAVYLSVAGDEEEHRMVSGFGGWDNYHRLARVKAQYDPENVFHR
FT                   NPNIKPA"
     MAQLNSTTVT GTAVAEFRSE FAGQVLEPGD SGYDQARTVV NPLVDLRPRV IAQCETVDDV        60
     VRAVRFGREH DLEIAVRGGG HGVGGEALTD GGIVIDLRRM SEVTVNPEEA NARVSGGATM       120
     GHLDRAAQPY GLATTGGRVS TIGVCGLVLN GGSGWLDRRF GLACDNLLAA ELVTADGDVV       180
     RASPEENPEL FWALHGGGGN FGVVTSMTLR LHELPSVNVS LLLWDAEAGP DVVRAYREFM       240
     GASTDDVCGG LMYMTAPSED FVPLWLVGRL VCAVLLIHTG RDPDEVARDL QPMREAGHVA       300
     EISAEMAYAD VQCLLDGPPG YHTYWSAEHV TTLPDEAVDR YCAGAQRMPA PSPSQYLLAP       360
     QGGTVSRALT DYPIPWRYAA WGVYPFGVWR DAADEERVVQ WAQSVRAEMS PWATGAVYLS       420
     VAGDEEEHRM VSGFGGWDNY HRLARVKAQY DPENVFHRNP NIKPA                       465
//

If you have problems or comments...

PBIL Back to PBIL home page