(data stored in ACNUC7421 zone)

EMBL: CP000088.PE580

CP000088.PE580       Location/Qualifiers
FT   CDS             complement(663757..666006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0582"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54620"
FT                   /db_xref="GOA:Q47SE7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q47SE7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54620.1"
FT                   /translation="MTARPAVRQPAGLPCPQPCNRYGYPMTNALLAEIDALVAGTHHNP
FT                   HALLGAHPGPEGVWVRALRPLARSVHVLLANGSRVELPHLHKGVFAGVVPGAEVPDYRL
FT                   VVRYDDGTELTVDDPYRHLPTLGELDIHLIQEGRHEELWRVLGAHTKRFPSVLGDTEGT
FT                   AFTVWAPNARGVRVIGDFNHWDGTGHPMRSLGSCGVWELFIPGVGDGTRYKYQVLGADG
FT                   VWREKADPVAFATQAPPETASVVFTSRYTWQDDEWLTQRAAADLHRKPMSIYEVHLGSW
FT                   RPGLSYRELADQLVDYVRELGFTHVEFLPVAEHPFGGSWGYQVTSYYAPTARFGSPDDF
FT                   RYLVDRLHQAGIGVFLDWVPAHFPKDDWALSRFDGTALYEHPDPRRGIHPDWDTLIFNY
FT                   GRTEVRNFLVANALFWLEEFHIDGLRVDAVASMLYLDYSRESGQWEPNAYGGRENLDAI
FT                   DFLRELNATAYRRNPGIAMIAEESTAWPGVTRSTDTGGLGFGFKWNMGWMHDTLSYLQH
FT                   DPVHRQYHHNEVTFSMVYAYSENYVLPLSHDEVVHGKRSLLYKMPGNEWQRCANLRALL
FT                   AYMWAHPGKQLLFMGNEIAQGDEWSHDAGVQWWLLRYPHHAGMRRLVADLNRLYRNTRA
FT                   LWSQDTVPEGFTWLDGGDASGNTLSFLRWGDDGSVLACLVNFSGRPHPERRVGLPYAGR
FT                   WREILNTDAVLYGGSGVSQPGIIEASEETPWQGQPASALVTYPPLGVSWLVFDGT"
     MTARPAVRQP AGLPCPQPCN RYGYPMTNAL LAEIDALVAG THHNPHALLG AHPGPEGVWV        60
     RALRPLARSV HVLLANGSRV ELPHLHKGVF AGVVPGAEVP DYRLVVRYDD GTELTVDDPY       120
     RHLPTLGELD IHLIQEGRHE ELWRVLGAHT KRFPSVLGDT EGTAFTVWAP NARGVRVIGD       180
     FNHWDGTGHP MRSLGSCGVW ELFIPGVGDG TRYKYQVLGA DGVWREKADP VAFATQAPPE       240
     TASVVFTSRY TWQDDEWLTQ RAAADLHRKP MSIYEVHLGS WRPGLSYREL ADQLVDYVRE       300
     LGFTHVEFLP VAEHPFGGSW GYQVTSYYAP TARFGSPDDF RYLVDRLHQA GIGVFLDWVP       360
     AHFPKDDWAL SRFDGTALYE HPDPRRGIHP DWDTLIFNYG RTEVRNFLVA NALFWLEEFH       420
     IDGLRVDAVA SMLYLDYSRE SGQWEPNAYG GRENLDAIDF LRELNATAYR RNPGIAMIAE       480
     ESTAWPGVTR STDTGGLGFG FKWNMGWMHD TLSYLQHDPV HRQYHHNEVT FSMVYAYSEN       540
     YVLPLSHDEV VHGKRSLLYK MPGNEWQRCA NLRALLAYMW AHPGKQLLFM GNEIAQGDEW       600
     SHDAGVQWWL LRYPHHAGMR RLVADLNRLY RNTRALWSQD TVPEGFTWLD GGDASGNTLS       660
     FLRWGDDGSV LACLVNFSGR PHPERRVGLP YAGRWREILN TDAVLYGGSG VSQPGIIEAS       720
     EETPWQGQPA SALVTYPPLG VSWLVFDGT                                         749
//

If you have problems or comments...

PBIL Back to PBIL home page