(data stored in ACNUC7421 zone)

EMBL: CP000088.PE585

CP000088.PE585       Location/Qualifiers
FT   CDS             674961..675563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0587"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54625"
FT                   /db_xref="GOA:Q47SE2"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SE2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54625.1"
FT                   /translation="MSPAEPQPGQDRQSLLHWRTVDIVVAAVIGVAVGIVFWVWSVLWN
FT                   ATTGLFAFFPPAQAILYGMWMVPGVLGGLIIRKPGAAVLTSIAAASLEMLLGTGWGVSV
FT                   LISGALQGLLSELVFLAFRYRSWGMGVAVLAGVAGGISPAIRDNLTYHVTWPLSYQVVY
FT                   GVLVLISAGLIAGAGSRVLTTRLAAAGALSPFASARG"
     MSPAEPQPGQ DRQSLLHWRT VDIVVAAVIG VAVGIVFWVW SVLWNATTGL FAFFPPAQAI        60
     LYGMWMVPGV LGGLIIRKPG AAVLTSIAAA SLEMLLGTGW GVSVLISGAL QGLLSELVFL       120
     AFRYRSWGMG VAVLAGVAGG ISPAIRDNLT YHVTWPLSYQ VVYGVLVLIS AGLIAGAGSR       180
     VLTTRLAAAG ALSPFASARG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page