(data stored in ACNUC7421 zone)

EMBL: CP000088.PE591

CP000088.PE591       Location/Qualifiers
FT   CDS             681924..682703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0593"
FT                   /product="electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54631"
FT                   /db_xref="GOA:Q47SD6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54631.1"
FT                   /translation="MNIVVLVKQVPDTETERKLDPADSTVDRAASDGVINELDEYAIEE
FT                   ALRLKEKHGGEVTILTVGPEQATDSIRKALSMGADKAVHVCDDALAGSDALQTAYAIAQ
FT                   TLGTLEYDLVILGSESTDARTGVVGAALAEYLGLPQLTLANKVDVDGTSVKIQRQTDDG
FT                   YQVVEATLPAVISVVEKINEPRYPSFKLIMAAKKKPVTKLSIAEAGIDADKVGLANATT
FT                   QVVDFAPAPPRTAGTVVKDEGNGGVLIADFLASKKFV"
     MNIVVLVKQV PDTETERKLD PADSTVDRAA SDGVINELDE YAIEEALRLK EKHGGEVTIL        60
     TVGPEQATDS IRKALSMGAD KAVHVCDDAL AGSDALQTAY AIAQTLGTLE YDLVILGSES       120
     TDARTGVVGA ALAEYLGLPQ LTLANKVDVD GTSVKIQRQT DDGYQVVEAT LPAVISVVEK       180
     INEPRYPSFK LIMAAKKKPV TKLSIAEAGI DADKVGLANA TTQVVDFAPA PPRTAGTVVK       240
     DEGNGGVLIA DFLASKKFV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page