(data stored in ACNUC7421 zone)

EMBL: CP000088.PE594

CP000088.PE594       Location/Qualifiers
FT   CDS             complement(685117..686271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54634"
FT                   /db_xref="InterPro:IPR016097"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SD3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54634.1"
FT                   /translation="MALFRRRRSDESAVAIDDFWSGWGELRSALAASIDEGAPVPAEVA
FT                   QQLDERVQRIHPSLTWEVSRAPEPAPTNLASSPFESLDSPEALLASLDAEPASARASYA
FT                   LTLRAGDDDEARVLAERWYRAAPEDAEWTFFPARPADHAQLSRTITWHDHELDLSHVSV
FT                   SMRVNHATGKIEAGVYHPDFMFLPEETQREVAEHVMLLAVGEDDMVRWVDSVKPLVEKP
FT                   LDPLPPTSVPAVVRQLSGMSGGGGWVTLQGRIPLRGAMQLSARHPLHRRDYPALTLYVQ
FT                   VVASYTEADKDRLPTGSSAAALESYALRLREMLGANGALFAVQTLGGQRVFHFYLDPES
FT                   GIFPEFEKAAREWSEGQASVTSELDPEWRIIEQLLKPIRKQLGR"
     MALFRRRRSD ESAVAIDDFW SGWGELRSAL AASIDEGAPV PAEVAQQLDE RVQRIHPSLT        60
     WEVSRAPEPA PTNLASSPFE SLDSPEALLA SLDAEPASAR ASYALTLRAG DDDEARVLAE       120
     RWYRAAPEDA EWTFFPARPA DHAQLSRTIT WHDHELDLSH VSVSMRVNHA TGKIEAGVYH       180
     PDFMFLPEET QREVAEHVML LAVGEDDMVR WVDSVKPLVE KPLDPLPPTS VPAVVRQLSG       240
     MSGGGGWVTL QGRIPLRGAM QLSARHPLHR RDYPALTLYV QVVASYTEAD KDRLPTGSSA       300
     AALESYALRL REMLGANGAL FAVQTLGGQR VFHFYLDPES GIFPEFEKAA REWSEGQASV       360
     TSELDPEWRI IEQLLKPIRK QLGR                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page