(data stored in ACNUC7421 zone)

EMBL: CP000088.PE599

CP000088.PE599       Location/Qualifiers
FT   CDS             690111..691193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0601"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54639"
FT                   /db_xref="GOA:Q47SC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q47SC8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54639.1"
FT                   /translation="MSEFIGKYRIITDFTTSGGGQCRWAFAVHGGKEYFIKEFLSPTYP
FT                   LPDSPGSKATKERKLRKCEQFEKHHREITKTLKRLSKPGGNLVITQDFFRHGAKYYKVT
FT                   EKIDTSALSLEEIAAEPMERRLLMLITVTHSLKILHQAGLVHGDIKPENILIKGTVKNY
FT                   HTAKLIDFDNAFFSGKPVPPDDMVGDLNYYSPETFGYLNGTVMGEQLTTASDIFALGLV
FT                   AVQFLTGSLVSFIPVEGAGRYPGELCAAGASYTTGLEEIFPQADSFVRKMLSAEPSKRP
FT                   TVDQVFDHVKELRSEVKKREDFITTTIVPRASSAKKSRLKGTLLKKSASTSREAEPTPR
FT                   NEKRSRLRGTLLEKRDSPPA"
     MSEFIGKYRI ITDFTTSGGG QCRWAFAVHG GKEYFIKEFL SPTYPLPDSP GSKATKERKL        60
     RKCEQFEKHH REITKTLKRL SKPGGNLVIT QDFFRHGAKY YKVTEKIDTS ALSLEEIAAE       120
     PMERRLLMLI TVTHSLKILH QAGLVHGDIK PENILIKGTV KNYHTAKLID FDNAFFSGKP       180
     VPPDDMVGDL NYYSPETFGY LNGTVMGEQL TTASDIFALG LVAVQFLTGS LVSFIPVEGA       240
     GRYPGELCAA GASYTTGLEE IFPQADSFVR KMLSAEPSKR PTVDQVFDHV KELRSEVKKR       300
     EDFITTTIVP RASSAKKSRL KGTLLKKSAS TSREAEPTPR NEKRSRLRGT LLEKRDSPPA       360
//

If you have problems or comments...

PBIL Back to PBIL home page