(data stored in ACNUC7421 zone)

EMBL: CP000088.PE6

CP000088.PE6         Location/Qualifiers
FT   CDS             6950..8935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tfu_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Tfu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAZ54046"
FT                   /db_xref="GOA:Q47U18"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q47U18"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAZ54046.1"
FT                   /translation="MSCGWSASPGRRVFPTLAYDARSITVLEGLEAVRKRPGMYIGSTG
FT                   ERGLHHLVQEVVDNSVDEALAGYATAIEVTLLADGGVRVTDNGRGIPVDPHPVEKKPAV
FT                   ELVLTTLHAGGKFDSKSYAVSGGLHGVGVSVVNALSTRLEVEVRRDGYLWTQSYEMTKP
FT                   VTELIRREPTDETGTQITFWPDGSIFETTTFNFETLSRRLQEMAFLNKGLSITIRDERP
FT                   EFVGDSPVTQTYYYEGGLSDFVRHLNATKEPVHSSIIAFEEAGDGIAVEIAMQWNQSYT
FT                   SSVHTFANTINTAEGGTHEEGFRAALTSIVNRYARDQKLLRDKDENLTGDDIREGLTAI
FT                   VSVKLADPQFEGQTKTKLGNTEAKSFVQKVCHEYLRDWLDRNPGEAKDIVTKATQAARA
FT                   RIAARQARELTRRKTLLESTSLPGKLADCQSTDPERCEVYIVEGDSAGGSAKGGRDPYY
FT                   QAILPIRGKILNVEKARIDRILKNNEVQAIITALGTGIHDDFDITKLRYHKIILMADAD
FT                   VDGQHIRTLLLTLLFRFMKPLIEAGHVYLAQPPLYKIKWDPRGTDVDYAYSDRERDEKI
FT                   AAGIAAGKKDPRPRDLVQRFKGLGEMNPSELWETTMDPERRVLLQVTLDDAAQADEMFS
FT                   VLMGEDVESRRAFIQRNARDVRFLDI"
     MSCGWSASPG RRVFPTLAYD ARSITVLEGL EAVRKRPGMY IGSTGERGLH HLVQEVVDNS        60
     VDEALAGYAT AIEVTLLADG GVRVTDNGRG IPVDPHPVEK KPAVELVLTT LHAGGKFDSK       120
     SYAVSGGLHG VGVSVVNALS TRLEVEVRRD GYLWTQSYEM TKPVTELIRR EPTDETGTQI       180
     TFWPDGSIFE TTTFNFETLS RRLQEMAFLN KGLSITIRDE RPEFVGDSPV TQTYYYEGGL       240
     SDFVRHLNAT KEPVHSSIIA FEEAGDGIAV EIAMQWNQSY TSSVHTFANT INTAEGGTHE       300
     EGFRAALTSI VNRYARDQKL LRDKDENLTG DDIREGLTAI VSVKLADPQF EGQTKTKLGN       360
     TEAKSFVQKV CHEYLRDWLD RNPGEAKDIV TKATQAARAR IAARQARELT RRKTLLESTS       420
     LPGKLADCQS TDPERCEVYI VEGDSAGGSA KGGRDPYYQA ILPIRGKILN VEKARIDRIL       480
     KNNEVQAIIT ALGTGIHDDF DITKLRYHKI ILMADADVDG QHIRTLLLTL LFRFMKPLIE       540
     AGHVYLAQPP LYKIKWDPRG TDVDYAYSDR ERDEKIAAGI AAGKKDPRPR DLVQRFKGLG       600
     EMNPSELWET TMDPERRVLL QVTLDDAAQA DEMFSVLMGE DVESRRAFIQ RNARDVRFLD       660
     I                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page